Medford Lakes, New Jersey 08055 HARD REPORT' · 8/21/1987  · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (2024)

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (1)

4 Trading Post Way Medford Lakes, New Jersey 08055

HARD REPORT'August 21, 1987 Issue #42 411111111111609-654-7272

Columbia

Eleiii

j

Mer I

FRONTRUNNERSPINK FLOYD JOHN COUGAR"LEARNING TO FLY" MELLENCAMP

Though the originals havedissolved into "Us andThem", this triumphantreturn makes it obviousthe world's big enough forPink and Floyd.

THE CARS"DOOR TO DOOR"

"You Are The Girl" popsup with a #3 HH debutand 100+ heavyreports-but the realAOR action is albumbased, Jackson.

RUSH"FORCE TEN"

The band that has tenplatinum Lp's withoutever having a top tensingle still doesn't haveone!! And ain't it great!!

Mercury

S ee

A&M

Relativity

John's evolution frommakeout artist to politicalactivist is now complete-and the single'sunquestionably the hottestthing on the street.

SQUEEZE

"HOURGLASS"What your musicalmenu really needs is asqueaky clean littlequirkburger of a tune,and that's whereSqueeze aims to pleeze.

THE BRANDOS"HONOR AMONG THIEVES"

You should have known amasterpiece like"Gettysburg" wasn't afluke. Could the Brandosbe CCR's heirs apparent?We think so.

NEW PLAY PRIORITIES...Loverboy "Wildside", Neil Young "Too Lonely",The Northern Pikes, "Things I Do For Money",Marc Jordan "This Independence", and Echo & theBunnymen, "Lips Like Sugar". . . . INSIDE!

CHARTSTARSMOST ADDED

1. The Cars "You Are The Girl" Elektra 127

2. Aerosmith "Dude (Looks Like A Lady)" Geffen 122

3. Melvin James "Why Won't You Stay" M CA 41

4. Whitesnake "Is This Love" Geffen 27

BIGGEST MOVERSCutting Crew "I've Been In Love Before" (94-62) 32

Whitesnake "Is This Love" (79-52) 27

Melvin James "Why Won't You Stay" (58-36) 22

Outfield "Bangin' On My Heart" (98-79) 19

INCREASE INDEXLoverboy "Notorious" 27

Insiders "Ghost On The Bach" 25

Grateful Dead "Hell In A Bucket" 21

Bryan Adams "Victim Of Love" 21

INCREASES

RECORD OF THE WEEKAEROSMITH "Dude (Looks Like A Lady)"

Two pages of raves, 122 OTB adds, 23 Top5 phone reports and a #16 debut-andwe're ready to call this one of '87's biggestcomebacks.

HEADLINESTHE CASTLE AT DISNEYWORLD

THE INDUSTRY'S NEWSPAPERAND KOJAN THE BARBARIAN

RICH SCHMIDT WINDHAM HILL NAIL.

NEW OWNERS AT WIBA

DAWN HOOD'S TALK WITH JOHN HIATT

WHITE LION'S VITO INCHRIS BLACK'S INTERVIEW

Copyright 1987 © The Hard Report, Inc

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (2)

Honor Among Thieves

Already on at:

WNEW WBCN WWDC KFOG KTXQ WLLZ WYNF 91X KLOL WHCN KILO WRCN KZELWOUR WAQX KXRX KJET WRXK WHFS WDHA WZEW WKFM WOXY WZYR KZOQ WKLCWMRY WGLU KMBY KDXR WKGR KTYD WBYR WEQX WKXL WMDK WWWV WXRC KATPWTOS KRCK WBRU KJOT WMGM KFMU KTAO KEZE WNGZ and more.. .

On Relativity records, cassettes, and compact discs., 1987 Relativity Records. Inc.

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (3)

HARD REPORT More On The Picks...Pink Floyd, "Learning To Fly", Columbia.... Let's faceit. When you reunite Gilmour, Ezrin, and the whole original crew--down to the engineers and tekkies, you're gonna get a legit PinkFloyd record. Between Waters and Gilmour, the band alwaysdid offer two relatively distinct accents. So let's just consider thisthe Gilmour -influenced piece. It's properly mysterious, a littledroll --and most of all distinct. Same as it ever was. And asmysterious and exciting as a new Floyd tune is, the media mag-nification inherent in the twin tours makes this track all the morespecial.

The Cars, "Door To Door", Elektra.... As we said in ourwrite-up last week, the band has scoring big with that first softsingle down to an exact science --and they'd be fools not to doit. Just as you'd be nuts not to take full advantage, which it ap-pears most of you are. Witness the tune's #3 debut behind 155 -station close-out play, over 100 of which list heavy rotation. Andwhile most of our reporters are chomping at the bit for some-thing with a little more bite, there are plenty of folks like KRQR'sJohn McRae who says, "I was expecting a pure pop washoutand instead I got something that I'm not afraid to power nextweek." Or as Slats at WHTQ put it, "The Cars aren't GONNAhave a hit with 'Girl' -- THEY'VE ALREADY GOT ONE!!".... Andnow that the album's here you can make everybody happy!"Strap Me In", "Wound Up On You" and "Double Trouble" arewhere to start

Rush, "Force Ten", Mercury.... And just as the Carscome standard equipped as mid -tempo female monsters out ofthe box, Rush again fires first with one for their fans. And as thebio sez, they're unmatched when it comes to album sales basedon AOR play. So why should they lead off with a glopped up popconfection? Fkn right, Man. Besides, they're bound to cut loosewith a serious Top 10 crossover sooner or later, and theforthcoming single with Aimee Mann could do it. Think howmany rock acts CHR has co-oped since "Power Windows" cameout. Make the artist exclusive count while you can, mates.

RECORD OF THE WEEKAerosmith, "Dude (Looks Like A Lady)". Geffen....Man Alive!! You don't have to hear it to add it --just read the sheet!We ran down about two pages of nothing but killer comments --with 122 first -week adds, a strong #16 debut, and 23 instant Top5 phone reports --including #1 requests at KPOI, WKLC, WNEW,KYYS, WRXK, KMJX and WDIZ, as well as #2 calls at KAZY,WZZO, KLOL, KILT, WYNF and WGTR. And that's about as biga blastoff as any major Dude could ask for.

John Cougar Mellencamp, "The LonesomeJubilee", Mercury.... John's evolution from the prototypeglampunk into a million selling spokesperson for agrarian reformis one of Rock's great Horatio Alger stories. And at the heart ofthe matter is the man's genuine concern for other human beingsas demonstrated by both his outside charitable efforts and thetone and texture of his recorded works. What's also interestingis the balance he's managed to strike between social conscious-ness and your basic backseat boogie. But on this project, thebattle of the sexes takes a decidedly secondary role. As Bob Guc-cione, Jr., so adroitly put it in "Spin", "'Scarecrow' is politicallyoutspoken and generally serious but contains tracks like'R.O.C.K. in the U.S.A.' and 'The Kind Of Fella I Am' that buoy it,like cork. They are safe and unrevealing." But there is no corkon "The Lonesome Jubilee". This is definitely music of the com-mon man --but even the working stiff's got Friday night to lookforward to. And when it rolls around, "Cherry Bomb", "Rudy TootToot" and "Hot Dogs" are what he'll be punching up down atMabel's.

Squeeze. "Hourglass", A&M.... Difford and Tilbrookremind me of what happens when two scrappy brothers wind upin the same classroom. Try as they might, they simply cannotand will not behave. Sure, they could sequester themselves in apractice studio and write standard pop hooks, and undoubtedlycome up with a real radio doozie. But then they'd be CrowdedHouse, right? Instead, the group continues to mine their lode ofunpredictable rhythms, sly and subtle double entendres, andsideshow melodies --all backed up by world class musicianship.Your audience has a right to have a little fun, too --and this coollittle change of pace could be just the ticket to tall calls. Alreadyon KFOG, WHCN, KBCO, WBAB, WBCN, WIOQ and DC101.

The Brandos. "Honor Among Thieves",Relativity.... Haven't heard "Gettysburg" yet? Then you'vemissed the best track from a new band on an indie label this year--and at the rate I can't stop rewinding, one of my very favoritetracks from anybody, period. It's just that magic combination ofgripping lyrics, killer harmonies and laser accurate guitarpunctuation that I know will slay the audience. Whoda thunk asong about the Civil War by a band on Relativity would make arun for the roses --but mark our words, the Brandos will stand asone of this year's biggest and brightest new acts in six months.Need further proof of their genius? Listen to "Honor AmongThieves", "Nothing To Fear", "Walking On The Water-and you'llhave a hard time taking it off your turntable.

NEW THIS WEEKLoverboy. "Wildside", Columbia.... Adds mean a lot,but increases mean more --and in just the second week Lover -boy streaks to #1 in our Increase Index with 27 play -ups. Theearly phones look great, too, with WAAF, WKDF, KDJK, KAZY,WGLU, WBLM and KPOI already into Top 5 territory. 15 moreadds gives it 136 to date, with 38 heavy, six power --and a 22-15* Hard Hundred move. WLNZ's Rick Van Gil bottom lines it,"The single has really put more interest back into the group.There really a lot of anxious ears to -leer the whole project"....Hey, give those people what they want--mo, mo, mo!! Start with"Hometown Hero".

Neil Young, "Too Lonely", Geffen.... Considering itsrelatively passive sound and slightly somber mood, "Long WalkHome" got a nice little radio ride, eh? And that Fourth of Julytiming didn't hurt either. We think th3 Fifth of July would havebeen the perfect time to switch to "Too Lonely". WIOQ has beenplaying it since day one, and we're talking classic Neil on theairwaves. Now you've got a hot remix to play with and the tourwill be in town before you know it. So...

The Northern Pikes. "Things I Do For Money",Virgin.... Though Canada has long been known for for-mula/hard rock, there is in fact a rich cutting edge culture up

north, and it's about time we got around to importing the bestof that ilk. Just take a look at Don Berns' playlist at CFNY orAndy Frost at CILQ. There's tons of stuff you never heard of, andyou can bet it's not April Wine sideways. Now those smart folksat Virgin, ever anxious to scoop their buddies stateside, havegone on a fishing expedition to the Great White Zone --andhooked a lunker. And we're not talking Plen and Naumann's sal-mon run a few weeks ago. The Pikes offer a really interestingblend of the Police, Pink Floyd and the Fixx--with definite twistof Edge -style guitar. Canada's answer to Jon Astley? Could be.

Marc Jordan. "This Independence", RCA.... IfMarc's name rings a bell, it's via his late 70's debut album,"'Mannequin". Though it didn't sell well, the collaboration withproducer Gary Katz and songwriting contributions of Donaldfa*gen made it an interesting footnote for any Steely Danophile.Well, now that rock and roll has cycled around to that lighter,more atmospheric style that typified his early work, Marc is backwith music much better suited to current fashion. And as befitsa guy who's been at it a decade and a half, this is quality writ-ing and performing. Check this one out --on KFOG now for twoweeks. Also be sure to audition another in-house favorite,"Catch The Moon".

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (4)

R.

PINK FLOYD

"LEARNING TO FLY"'

THE BEGINMNG OF "A MOMENTARY LAPSE OF REASON"Produced by Bob Ezrin and David Gilmour. Management: Steve O'Rourke, EMKA Productions, London. "Columbia," jail are trademarks of CBS Inc. 2 1987 CBS Inc.

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (5)

THEHARD REPORT NEW THIS WEEK

Echo and the Bunnymen, "Lips Like Sugar", Sire/WB.... This past week Redbeard remarked about the format's on-going hesitation on the Cure, and I've got to believe our overall hesitation on Echo represents much the same sort of balkiness.This act sells records --but so does Slim Whitman. They fill big hall --but so do the Monkees. But how many supposed New/Alterna-tive acts sound this good? "Lips Like Sugar' would be a terrific tune by anybody --and it could be especially valuable to you withtheir retail and touring base. You can have great success with the best of what modern music has to offer, and we can't think of a

stronger act --or song --to start with.

IMPACT TRACKSMelvin James, "Why Won't You Stay", MCA.... Oneof the faster starting debut acts this summer swings into itssecond week with another 41 adds --for a rather remarkable two-week 100 -station total. 10 quick increases (KICT, KRQR,WQFM, KLPX) and five heavies bring home our third longestHard Hundred move, 58-36, and we Lilly expect at least another25 adds next week. KBPI's John Edwards says, "Good reactionrecord. We're getting a lot of curiosity calls on it".... KRQR'sJohn McCrae adds, "I think it sounds great on the radio station--up light to medium".... From KAZY's Tim Jeffreys, "The produc-tion alone on this record is enough reason to play it. Talk aboutdeveloping a hook".... WGTR's Bearman asks, "Who the hell isMelvin James...and why haven't we t-eard from him 'til now?"....and WYNF's Charlie Logan calls it "One of those songs youknow you're in love with after ten seconds --and you know it's a

Whitesnake, "Is This Love", Geffen.... One of the besttesting songs on the street (just ask WLLZ's Jim Pemberton)moves into the limelight with a big-time 27 station add ---week--56 now playing and 7 increases crank up our second longest79-52 move. We're already looking at a solid slate of majorswith heavy play here, including KAZY, KBPI, KDKB, KGB, KISS,KRQR, WDVE, WYNF and, of course, WLLZ. WRUF's JasonTyler comments, "It's in the same league as McDonald's sellinganother billion burgers. You know it's going to happen"....WAPL's Rick Panneck tells us, "Whi e our competitors poundWhitesnake, we're going on the second track. Top 5 retail sincethe album's release".... From DVE's Anthony Alfonsi, "Whites-nake is three for three here, and 'Is This Love' showcasesCoverdale's vocal range"....

Fleetwood Mac, "Little Lies", WB.... If you've evenglanced at the Most Added listings the past couple of weeksyou know the time is right for "Lies". It lands 21 more reportsthis issue, with 90 now playing and heavy action at 31, includ-ing KFOG, KLOL, KZAP, WBCN, WCCC, WHJY, WPYX andDC101. Naturally, it's back with more killer charts --Up 49-34*,our fifth longest gain this week.

Glen Burtnick, "Follow You", A&M.... That add/in-crease spiral just continues to build: Glen's lookin' at new airon 16 (#9 Most Added), with solid plus across-the-board playjumps --13 total, including KTYD, KZEL, WAQX, WTPA, CILQ,KLOS, WFYV, WRXK and KBPI, where Jon Edwards reports,"It's happening for us and we're real happy to support it. Goodphones on breakout rotation".... Now on 97, heaviest on KDKB,KMBY, KQWB, KTYD, KZEL, WAQX, WDHA, WMDK, WTPA andWWZU. "Follow You" finds a 50-41* hole in the Hard Hundred.

David Bowie, "Never Let Me Down", EMI/MAN-HATTEN.... Take your cue from just about any indicator youplease and "Never Let Me Down" comes up with momentum tospare. 15 adds pumps the count to 1- 9, with puh-lenty of majorheavy reports. KBCO, KFOG, KLOS, KOME, KRXQ, KSJO,WBCN, WNEW, and DC101 to name a few, with KYYS, WHCN,WIOQ, WPLR and WMMR leading in Power reports. It's up atCFOX, KATP, KLOS, KWIC, WHMD, WIZN, WWCT, WWRX,CILQ, KBER and WNGZ. WFYV's Lex Staley adds for the con-

cert tie in ---further explaining, "I will go so far as to say it's thebest track on the album and I'm sorry they waited so long to getto it." Hey, just be glad they're not handing you a crispy critter,Lexman.

Y&T, "Temptation", Geffen.... One of hard rock's mostreliable live acts locks a credible add this week with their newtune --and a good, solid debut to match. It's new on KBPI,WLLZ, KDJK, KFMQ, KRXQ, WDHA, WFYV, WKLS, WQFM,WKLC and more, 16 total. And if that's not a quality showing,color me contagious. New at #82, with 33 reporters now list-ing current play.Mr. Mister. "Something Real", RCA.... Hop on andyou'll be happy. KRQR's John McCrae is already into increased,play, saying "I was a little hesitant just because their last twosingles were such soft rock, but we have no problem with thisone".... From WHTQ's Mr. Slats, "This tune sounds like highgloss Turtle wax, a smooth tune".... In addition to KRQR, the newincreases include WVVV, WOUR, KSQY, KMBY, WAPL andWFYV, with heaviest air now at CHOM, KBER, KFMG, KSJO,KXRX, WAOR, WIMZ, WPLR and WZZO. Currently on 109, mostnotably KYYS, KSHE, KOME, KMOD, KGB, KBPI, KBCO andKATT. #4 Most Added with 27, underlined 41-31 on the HardHundred.

Cutting Crew, "I've Been In Love Before", Vir-gin.... Between their track record and this tune's intense MTVand CHR rotation, you shouldn't have to think long. The AORcharts are mondo motivational, too --as the Crew's latest landsthis week's longest Hard Hundred advance, 94-62. It's got addson 22, ups on 7 including WKLS, KXRX, and KBER. Nowheaviest on KFOG, WKGR, WNGZ, WPDH and DC101.

The Fabulous Thunderbirds, "How Do You SpellLove", CBS Associated.... Let's have a little more fun onthe radio!! And adding and upping this baby is the perfect placeto start. Let's see who's got it heavy: Try KAZY, KFOG, KSHE,KXRX, KZEW, WDHA, WFYV, WHCN, WIOQ, WPLR, WXRC andabout six more. The Current list is now 110 deep, with adds on16 and ups at 8, including KSHE, KZEW, WIOQ, WFYV andKMBY. Underlined again this week, 32-24*.

Billy Idol, "Mony Mony" Live, Chrysalis.... Billy'sguaranteed to please live rip -em up arrived late at radio, but stillcollected adds at 14, including KGB, KSHE, KXRX, WKLS, andWRIF. And keep in mind that when we say "late" we mean after3pm Tuesday. Considerings? They're a mile deep. As KRQR'sJohn McCrae said, "It's in for next week. Best thing he's donein years".

Paul Kelly and the Messengers, "Darling ItHurts", A&

Kelly-andstarting to see phone movement here,

with KICT and KLAQ logging in Top Five response --and KOME'sSteven Page saying, "It's starting to do well for us in all dayparts.Great hook".... Paul picks up 14 more adds --keeping his ultra -consistent build on a large roll --with play increases at 7, includ-ing KMOD, KOZZ, WQFM, WWTR, KATP and KZOQ. Now heavyat KBPI, KZEL, WEBN, WOUR, WTPA, WXRC and WXXP. Up

29-25 on the Hard Hundred.

BILL HARDEditor andPublisher

DAWN HOOD AMY DAHLMANAdvertising Music Director

New/Alternative Ed CHRIS BLACKProductionAssistant

STEVE SUTTON ERIC SCHNEPFRadio Editor Data Systems

MIKE COOPER LEE CARTERContributing Editors

SUSAN HEISSEditorial Assistant

The Hard Report is published weekly by the Hard Report Inc 4 Trading Post Way Medford Lakes, NJ 08055Material may not be reproduced without permission

RADIO REPORTS MONDAY & TUESDAY 10 AM7PM ESTCOMMENTS DEADLINE WEDNESDAY 12 NOON(4309) 654-7272 FA. ( C/ 9 ) 5 4 -IS El 5 2

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (6)

Reprise RecordsNational Promotion

Ricb FitzgeraldLinda BakerMichael LinehanMarc Ratner

WOMONNIOMB

Reprise RecordsField Promotion

Barbara BalcblckCleveland

Jerry BarrettDallas

Sue BrettSeattle/Portland

Gary BriggsSan trancisco/Sacramento

Susan DesmaraisBaltimore

Bob DivneyHart ford

Scott FreemanKansas St. Louis

Lisa GilesHouston

Drew GitlinLos Angeles

Andrew GovatsosBoston

Patrick GraeberDetroit

Warren HudsonAtlanta

Tim HurstCincinnati

BillJanisNashville

Nancy LevinDenver

John McAlisterMiami

Ken OrnbergMinneapolis

Randy Ostin\ii >leg()

Hillary ScribnerNew Thrk

Katie SeidelCharlotte

Bob WeilPhiladelphia

Richard Wolod

To Begin Again. LaunchingAugust 1987 it, 198'. Reprise Records

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (7)

THERD REPORT TAKE TWO

Hooters, "Satellite", Columbia.... Lookin' for the nextway to go with the Hoots? "Satellite' is continuing to come onstrong, advancing 9 positions on the HH this week (54A5*) afterpicking up 14 adds (KLOS, WCMF, WLZR, WHJY, WYYS, KLOLand KRQR), and upped rotations at 6. The phones are pickingup the buzz, too, with 5 reporters registering Top 5 requests for"Satellite". All this happening while "Johnny B" keeps up itscrusade on the chart, stepping 3-2 HH in the face of the heaviestrelease schedule this year. Look for increases to be the ticket topush "Johnny' over the top. Meanwhile, "Satellite" is warming upand is ready to take the reins when the time comes....

The Cult. "Wild Flower", Sire/WB.... If you haven't goneback to the re -mix of "Flower', better get on the stick. All in-dicators now say that "Wild" will equal and probably out performeven the highly acclaimed "'Removal Machine". 15 adds with 4increases was enough to power the track 7 positions on theHundred (56-491 this week and reaction tells us the album isworking on the street as well. WHJY's Glenn Stewart reports,"Very strong sales in this market".... And the calls are starting atKOZZ and KQWB. It was an easy add for KAZY's Tim Jeffreys,"'Electricity' has been one of my favorite albums of this year, andwe had no problem going with 'Wild Flower'. Besides, I loved itwhen they trashed their equipment on Joan Rivers' show".... 73total on, with plenty of room for advancement.

Starship, "Babylon", Grunt/RCA.... When "Nothing'sGonna..." arrived on the scene last year, everyone was talkingabout the renewed strength and character that was apparent inGrace's vocal performance. Now Grace is center stage onceagain with "Babylon" and reporters are letting us know that thisis the definitive cut for AOR. 14 adds (WLNZ, WKLS, KLOL,WDVE) and increased play at KZEW bounds the track 14 posi-tions on the Hundred 70-56*, as the total on grows to 48.

Tom Kimmel, "Tryin' To Dance", Mercury.... It'sbreakout week for Mr. K, with 13 adds more than doubling thetotal on. New this week at KBPI, WMGM, KATP, KICT and 'ZZQjoining heavyweights KTXQ, WEGR, WLLZ and WONE and 12more already committed. And FLASH -- Hot off the Press: TomKimmel joins Heart for the remainder of their sell-out summertour. Expect that exposure, coupled with the MN rotation totranslate into a big time recognition factor amongst your listen-ing audience. "Dance" breaks the HH this week, with a 97* debut.

Sammy Hagar, "Returning Home", Geffen.... In-creases and adds came easy to Sammy this week as 10 com-mit (WNEW, WKDF, KZEL, KQRS, KTYD) and 12 up airplay(KGB, WCMF, WQFM, KLOS, KOME, KILO) giving "Home"another solid boost on the chart 48-44* HH. Still hesitating? GiveTim Jeffreys a call at KAZY, where he reports that testing resultson Sammy have been blowing the top off the scale....

Hege V, "House Of Tears", MTM Records.... Con-dolence cards are still arriving at the V household as fans paytheir respects to the Heg-man's beloved Hearse, which passedon unexpectedly on the road a few weeks ago. But the showmust go on, and 11 stations roll out the red carpet for the nexttrack from Hege, and a couple of quick listens will clue you in tothe secret of this guy's appeal. Already on WKQQ, KATP,WHMD, KICT and WKWQ as the 12" just begins to surface.'KQQ's Stacey Yelton, "Hege V could be anybody, but we knowhe is the son of George Hamilton IV. But that still isn't the reasonwe're playing the record. It's that killer harmonica and biting vo-cals. Whew! Let me out of that House!"....

Omar And The Howlers, "Mississippi Hoo DooMan". Columbia.... While the single "Canebreak" picked upsome action on the AOR side, most mainstreamers are happywith da "Man", which snagged another 8 adds this week, withWBAB, WYNF, WDIZ, WMMR and WMGM new, and increasedair at 3 more. Total on grows to 40, while Omar has no troubleon the chart, making a hefty advance 73-65* on the Hundred.

Marillion, "Sugar Mice", Capitol.... Here's a song that'sa pleasure to go back and listen to again. Dig out that CD -singlethat Tusken sent 'cha, lean back and let the laser do the talkin'.You've got to admit that the "Lamb Lies Down on Kayleigh"resemblance is quite comfortable, and the high/low enhance-ment courtesy of the CD makes "Sugar" one of the easiest tunesout there. 4 adds this week with KATP, KATT, KGRQ and WWTRall in; increased air at KLBJ, and Tom Starr at WOUR reports Top5 phones. 18 reporters now on as "Sugar' debuts on theHundred, 96*....

Roger Daltrey. "Hearts Of Fire", Atlantic.... Rogerkeeps 'em asking for more with this one, pulling another 7 addsout of the hat (KZAP, KMBY, WZZO) while increasing rotation inL.A. at KLOS. Disillusioned by the first one? Buck up and take aplunge with this one -listen pop monster. 40 already on as thecut gains on the Hundred 72-68*.

HARD ACTS TO FOLLOW . . .Insiders, "Ghost On The Beach", Epic.... Registering#2 on the Increase Index in a week of major release action ispretty damn smooth, I'd say, and the Insiders prove they'remade of tough stuff, managing 25 increases and 11 addsdespite the cloudy forecast. "Ghost" snags power play at the'LUP and WRUF, heavy at 28 others, while the total on climbsto a truly dignified 143. Planning on a little vacation time? Besure to take along the disc for your CD walkman, and check outthe depth on this fine debut. 7 -position jump on the Hundred24-17*.

Helix, "Wild In The Streets", Capitol.... A strong recep-tion for Helix this week as 5 joined the ranks of WLLZ, KISS,WQFM, KMOD, CILQ and 5 more, bolstering the grand total to15 on this riveting return to the Hard side of rock for these guys.Don't forget, we're not talkin' about some new kids on theblock...Helix has made many friends and fans during the pastsweeps and it looks like "Wild" may be another solid notch in

their belts. WHJY's Glenn Stewart knows the score, "Helix isgood for the nighttime head bangin' crowd. We've dealt withthem in the past and the kids love KATP's Dale Miller,

"Helix is very strong in the Amarillo market; they have been foryears. We've already got instant phones on what I think is oneof their best OTB releases"....

The Silencers. "Painted Moon", RCA.... This remark-able band broke Top 30 of the HH last week, and it was nosurprise to us when the track continued to make strides point -wise in this critical week. We clocked 6 adds with WHCN, KFOGand CILQ on board, but it was the increases in rotation that real-ly made headlines this week. Up at 8 (KLOL, WAAF, WTPA,WIZN, KSQY) with plenty of potential for future growth. And ifit's raves you want...'100's David Anderson, "What a greatmelodic song! It's a record that's really grown on me".... AndKQWB's Ty Banks, "We're really getting into the Silencers. It's

a record that sounds better with every listen".... 126 total on, HH26-26*.

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (8)

EchoThe Bunnymen

"Lips Like Sugar"THE NEW PRO

Produced by Laurie Latham for Lol Productions Ltd. Gil Norton and Echo & The Bunnymen Management: Direct Management Group. Steven Jensen & Martin Kirkup C)1987 WEA Records Ltd.

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (9)

HARD ACTS TO FOLLOW . .HIARD REPORT

TNT, "Everyone's A Star", Mercury.... What do WBCN,WBAB, KBPI, KAZY, WQFM, WLLZ, KILO, KTXQ, WKDF andWYNF all have in common? Come on, you know! Believe it ornot, TNT has admittedly scattered airplay at this point...but, lookcarefully...the bulk of those playing are the Majors! Hey! Aren'tthey the ones who usually hold out 'til the last minute?! Not thistime around...as TNT picks up 6 this week, swelling the total onto 25; a number strong enough to slide the track onto theHundred with a debut at 94*. Keep your eyes/ears on thisone...could be a significant sleeper of the year.

Brian McDonald Group,"Life Is A DesperateBusiness", Columbia.... Brian pulls a fast one this week,doubling his amount of stations playing, with 6 adds (WRUF,KRQR, KMOD, KISS, WONE) pushing that total on to 12. Haveyou taken the time to check this one out? We find that "Close -Up" hook to be irresistible after a few short listens, and we'refinding success stories in markets where the tune is being givena fair chance. "Life" just missed the Hundred this week...Watchas this one prepares for a sneak attack....

Guns N' Roses, "Welcome to the Jungle", Gef-fen.... Predictibly G N' R has jumped out on the metal side,with "Welcome" playing to great phone reaction at the harderrockin' reporters. While the build has been slow, the companyis great with KTXQ, WBCN, WNOR, KKDJ, KNCN, KRXQ, KLAQ,KNAC, KISS and KEZE just some of the participants. If you'rereally not convinced that "Jungle is one of the premiere debutsongs of the year after all this time, we suggest the old tried andtrue night time Smash or Trash phone test. We think you'll besurprised. "Jungle" breaks through onto the Hundred this weekwith a 99* debut.

Faster puss*cat, "Don't Change That Song",Elektra.... Big strides on the Hundred for the 'Cat this week,with 4 adds (WCCC, KBER) and increased air at CILQ. We weresurprised to hear how a majority of repo rte rs have not found thetime to check out this bona fide burger as of yet. Guess what?Two weeks on the HH, with 27 total on and no where to go butup, spells LOCATE AND LISTEN to ye not yet initiated. Nicemove on the Hundred: 97-88*.

David Lynn Jones, "Bonnie Jean (Little Sister)",Mercury.... We got tipped to this one when KDJK's BeaverBrown went crazy on the phone about this song last Tuesday.And we've got to agree, one listen to this baby, and the JCMcomparisons will fly. With the 12" out of the chute this week,David picks up adds at KZEL, KATP, KGRQ and KMOD. Certain-ly a Must Listen record.

co*ck Robin, "Just Around the Corner", Colum-bia.... The continued weekly build is just what we like to see ina project like this, and 4 more add this week as WOUR, WKGR,WWCT and WMAD come aboard, driving the total on to 31."Corner's got power play at the 'LUP, and top 5 phone actioncoming in at KFOG, but we believe there's alot more to this storythan just the scattered play. Honestly, you can't miss the hookin this one, and neither will your audience. Act fast or surrenderthis guarenteed phone burner to your top 40.

Pretenders, "Where Has Everybody Gone", WB....We're happy to say this daring venture has paid off handsome-ly for Chrissie and friends. After all, they took a diversion fromtheir signiture sound and have come up with not only an across-the-board AOR success story, but a lead track to a James Bondbox office smash! Not too bad for a hard day's work.... Num-bers wise, here's the scoop.... 4 adds plus the 15 increases helpmaintain the track in heavy traffic this week holding steady at27-27*.

The Cure, "Just Like Heaven", Elektra.... Redbeardtells the tale we love to hear, "You don't have to be researchoriented to understand Top 5 sales since the first week of releasein Dallas/Ft. Worth. Check your retail anywhere in the countryon The Cure. On stage, they did 8000 people here in the big-gest hall in town".... 6 adds this week (KBCO, WLLZ, WLZR,KLBJ, KTYD) as the total on grows to 31. On the Hundred: 77-71*.

John Hiatt, "Thing Called Love", A&M.... Our favoritefrom "Bring the Family" locks up another 3 adds this week asKNCN, KFMQ and WONE join WLLZ, WKLS, CHEZ, KFOG and16 more. Figure in the 4 increases and you've got enough ammofor the 95-90* advance. And the raves are there, not only for"Thing" but for further play on this fine Lp too. WBRU's KurtHirsch, "My choice for album of the year. It's got 10 cuts worthof depth".... 'YNF's Charlie Logan, "We're skipping ahead to'Have a Little Faith'. That song blew me away in concert. It's kindof an emotional rocker; a mover"....

Stevie Ray Vaughan/Dick Dale, "Pipeline".Columbia.... Checked the lines at the box office recently? Themovie has all the indications of becoming a cult/summer clas-sic, and a quick check at retail tells us that the soundtrack isn'tfar behind. "Pipeline" itself is a classic, but the number SRV andDD do on it deserves your undivided attention. With 29 now play-ing, and increased air at CILQ, WQBK and KZEL, the cut advan-

ces 89-86* HH.

SUBSCRIBE NOW!Company

Street

City, State, Zip

Telephone No.

Your Name & Title

El 1 YEAR $200.00 El RADIO $175.00

THE HARD REPORT4 TRADING POST WAYMEDFORD LAKES, NJ08055

FOR MORE INFO:(609) 654-7272

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (10)

"Dude (Looks Like A Lady)"127 New This Week - #2 Most Added

D 16* Hard Hundred"Aerosmith is back with a vengeance. This 'Dude' sounds like a top 10 hit.Initial reaction is tremendous, and with all the copycat Aerosmith bandsaround, it's extremely satisfying to hear the real thing!"

PAM EDWARDS, KGB

"Aerosmith is just blowing the phones off. These boys keep a train rollin'with this one! Already #2 Most Requested." CHARLIE LOGAN, WYNF

"This is outta sight! The first time I played it I thought the CD was mis-tracking. Every time I play it, it's a party." T-BONE, KISS

"The phones are blowing out, #2 after the first week. How much moreautomatic does it get?" BEARMAN, WGTR

"How hot is the Aerosmith? So hot that within the first 24 hours we had it,someone ripped off the CD! I confess, if I had a CD player, I'd be guilty ofstealing it. It's the best Aerosmith song I've ever heard."

BETH KEPPLE, WKLS

"Aerosmith was always the perfect blend of blues, funk and hard rock.`Dude' is just what I needed, and they are back in the fine style I love somuch." ERIN RILEY, WMMR

"Dude' is a really great Aerosmith song. It works well and phones arepicking up too. It sounds like they're having a blast!"

STEPHEN PAGE, KOME

"I love this Aerosmith record. Their best since 'Walk This Way'''.TIM JEFFREYS, KAZY

We're Talkin' Hard Rock! GEFFEN

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (11)

7.lHARD REPORT HARD HUNDREDLw Tw Artist

1 1 J.C. MELLENCAMP3 2 HOOTERSD 3 THE CARS2 4 GRATEFUL DEAD6 5 GREAT WHITE9 6 GRATEFUL DEAD4 7 CRUZADOS7 8 DEF LEPPARD5 9 WHITESNAKE

14 10 RICHARD MARX17 11 U210 12 JON ASTLEY16 13 BRYAN ADAMS13 14 TOM PETTY22 15 LOVERBOYD 16 AEROSMITH

24 17 INSIDERS21 18 ROGER WATERS19 19 JOE WALSH8 20 HEART

20 21 BEAT FARMERS11 22 LOS LOBOS28 23 DAVID BOWIE32 24 FABULOUS T -BIRDS29 25 PAUL KELLY26 26 THE SILENCERS27 27 PRETENDERS34 28 DEF LEPPARD30 29 DIO18 30 SAMMY HAGAR41 31 MR. MISTER12 32 INXS/J. BARNES33 33 EUROPE49 34 FLEETWOOD MAC15 35 38 SPECIAL58 36 MELVIN JAMES37 37 JON BUTCHER38 38 WARREN ZEVON23 39 PATTY SMYTH40 40 SUZANNE VEGA50 41 GLEN BURTNICK25 42 CHARLIE DANIELS44 43 CROWDED HOUSE48 44 SAMMY HAGAR54 45 HOOTERS46 46 STEPPENWOLF52 47 PETE BARDENS51 48 GRATEFUL DEAD56 49 THE CULT35 50 STARSHIP

1

23

445

6

778889

99

1010101011

Tracks"Paper In Fire""Johnny B""You Are The..." 12""Touch Of Grey""Rock Me""Hell In A...""Bed Of Lies""Women""Here I Go Again""Should Have Known...""Where The Streets...""Jane's Getting...""Victim Of Love""All Mixed Up""Notorious""Dude (Looks...)""Ghost On The Beach""Sunset Strip""In My Car""Who Will You...""Dark Light""La Bamba""Never Let Me...""How Do You Spell...""Darling It Hurts""Painted Moon""Animal""Where Has Everybody...'"I Could Have...""Boys' Night Out""Something Real""Good Times""Carrie""Little Lies""Back To Paradise""Why Won't You Stay""Wishes""Detox Mansion""Isn't It Enough""Solitude Standing""Follow You""Bogged Down In...""World Where...""Returning Home""Satellite""Hold On""In Dreams""West L.A. Fadeaway""Wild Flower""It's Not Over..."

Lw Tw Artist Tracks31 51 OUTFIELD "Since You've..."79 52 WHITESNAKE "Is This Love"45 53 MASON RUFFNER "Dancin On Top/World"39 54 SAMMY HAGAR "Give To Live"36 55 THE CALL "I Don't Wanna"70 56 STARSHIP "Babylon"57 57 URGENT "I Can't Take It..."42 58 FLEETWOOD MAC "Isn't It Midnight"43 59 JOHN WAITE "These Times..."61 60 MOTLEY CRUE "Wild Side"60 61 GRATEFUL DEAD "When Push..."94 62 CUTTING CREW "I've Been In Love..."69 63 REPLACEMENTS "Alex Chilton"74 64 THE BRANDOS "Gettysburg"73 65 OMAR/HOWLERS "Mississippi..."71 66 DEF LEPPARD "Hysteria"47 67 U2 "Spanish Eyes"72 68 ROGER DALTREY "Hearts Of Fire"59 69 RICHARD MARX "Don't Mean Nothing"62 70 DANNY WILSON "Mary's Prayer"77 71 THE CURE "Just Like Heaven"55 72 FABULOUS T -BIRDS "Stand Back"53 73 TWISTED SISTER "Hot Love"68 74 THE BEARS "Fear Is Never..."66 75 NEIL YOUNG "Too Lonely"76 76 ROBERT VAUGHN "Justice"83 77 HUEY LEWIS/NEWS "Doing It All..."64 78 MARILLION "Incommunicado"98 79 OUTFIELD "Bangin' On My..."65 80 FLEETWOOD MAC "Seven Wonders"75 81 TESLA "Rock Me To..."D 82 Y&T "Temptation"

82 83 U2 "In God's Country"93 84 co*ck ROBIN "Just Around..."81 85 U2 "I Still Haven't..."89 86 S.R.VAUGHAN "Pipeline"63 87 TOM KIMMEL "That's Freedom"97 88 FASTER puss*CAT "Don't Change..."D 89 DEF LEPPARD "Excitable"

95 90 JOHN HIATT "Thing Called Love"D 91 HEART "There's The Girl"

91 92 ECHO/BUNNYMEN "New Direction"99 93 FIRE TOWN "Rain On You"D 94 TNT "Everyone's A Star"

100 95 PETE WYLIE "Sinful"D 96 MARILLION "Sugar Mice"D 97 TOM KIMMEL "Tryin' To Dance"D 98 GRATEFUL DEAD "Throwing Stones"D 99 GUNS N' ROSES "Welcome To The..."D 100 BILLY IDOL "Mony Mony Live"

MOST ADDED TRACKSARTIST TRACK TOTAL POWER HEAVY MEDIUM LIGHT

THE CARS "You Are The Girl" 127 10 86 31

AEROSMITH "Dude (Looks Like...)" 122 3 53 62 4

MELVIN JAMES "Why Won't You Stay" 41 1 19 21

MR. MISTER "Something Real" 27 1 20 6

WHITESNAKE "Is This Love" 27 5 18 4

CUTTING CREW "I've Been In Love..." 22 3 16 3

FLEETWOOD MAC "Little Lies" 21 1 8 12

FABULOUS T -BIRDS "How Do You Spell..." 16 2 10 4

GLEN BURTNICK "Follow You" 16 9 7

DAVID BOWIE "Never Let Me Down" 15 1 9 4

LOVERBOY "Notorious" 15 12 3

Y&T "Temptation" 15 1 6 8BILLY IDOL "Mony Mony Live" 14 5 10

HOOTERS "Satellite" 14 3 9 2

PAUL KELLY "Darling It Hurts" 14 10 4

THE CULT "Wild Flower" 13 11 2

STARSHIP "Babylon" 13 2 8 3

TOM KIMMEL "Tryin' To Dance" 13 4 9

U2 "Where The Streets..." 13 1 6 6THE BRANDOS "Gettysburg" 12 6 6

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (12)

HARDTHE REPORT

JAC,AIRPLAY ANALYSIS

13.A.D. E.Lw Tw Artist Tracks Lw Tw Artist2- 1 J.C. MELLENCAMP "Paper In Fire" 1- 1 J.C. MELLENCAMP "Paper In Fire"1- 2 DEF LEPPARD "Women" 3- 2 HOOTERS "Johnny B"D- 3 THE CARS "You Are The..." 12" 4- '3 JON ASTLEY "Jane's Getting..."5- 4 GRATEFUL DEAD "Hell In A Bucket" D- THE CARS "You Are The..."D- 5 AEROSMITH "Dude (Looks Like...) 6- 5 U2 "Where The Streets..."6- 6 BRYAN ADAMS "Victim Of Love" D- 6 AEROSMITH "Dude (Looks Like...)"8- 7 RICHARD MARX "Should Have Known..." 8- 7 GRATEFUL DEAD "Hell In A Bucket"9- 8 GREAT WHITE "Rock Me" 5- 8 WHITESNAKE "Here I Go Again"4- 9 CRUZADOS "Bed Of Lies" 9- 9 GREAT WHITE "Rock Me"

13-10 JON ASTLEY "Jane's Getting..." 2-10 GRATEFUL DEAD "Touch Of Grey"10-11 TOM PETTY "All Mixed Up" 11-11 RICHARD MARX "Should Have..."14-12 U2 "Where The Streets..." 7-12 DEF LEPPARD "Women"19-13 LOVERBOY "Notorious" 20-13 DEF LEPPARD "Animal"15-14 SAMMY HAGAR "Boys' Night Out" 23-14 LOVERBOY "Notorious"21-15 INSIDERS "Ghost On The Beach" 14-15 ROGER WATERS "Sunset Strip"7-16 HOOTERS "Johnny B" 15-16 TOM PETTY "All Mixed Up"

16- 7 ROGER WATERS "Sunset Strip" 13-17 BRYAN ADAMS "Victim Of Love"11-18 PATTY SMYTH "Isn't It Enough" 18-18 FABULOUS T -BIRDS "How Do You Spell..."24-19 DEF LEPPARD "Animal" 12-19 CRUZADOS "Bed Of Lies"23-20 BEAT FARMERS "Dark Light" 22-20 INSIDERS "Ghost On The Beach"12-21 WHITESNAKE "Here I Go Again" 21-21 PRETENDERS "Where Has Everybody..."27-22 DAVID BOWIE "Never Let Me Down" 32-22 PAUL KELLY "Darling It Hurts"18-23 DIO "I Could Have Been..." 37-23 DAVID BOWIE "Never Let Me..."41-24 FABULOUS T -BIRDS "How Do You Spell..." 34-24 PETE BARDENS "In Dreams"34-25 MR. MISTER "Something Real" 33-25 DIO "I Could Have Been..."17-26 HEART "Who Will You..." 26-26 SUZANNE VEGA "Solitude Standing"D-27 WHITESNAKE "Is This Love" 35-27 BEAT FARMERS "Dark Light"

32-28 THE SILENCERS "Painted Moon" 31-28 SAMMY HAGAR "Returning Home"3-29 38 SPECIAL "Back To Paradise" 43-29 MR. MISTER "Something Real"

22-30 LOS LOBOS "La Bamba" 38-30 THE SILENCERS "Painted Moon"D-31 FLEETWOOD MAC "Little Lies" 10-31 INXS/J. BARNES "Good Times"

36-32 GLEN BURTNICK "Follow You" 36-32 GRATEFUL DEAD "West L.A. Fadeaway"D-33 MELVIN JAMES "Why Won't You..." 28-33 JOE WALSH "In My Car"

26-34 JOE WALSH "In My Car" D-34 MELVIN JAMES "Why Won't You..."20-35 GRATEFUL DEAD "Touch Of Grey" 17-35 LOS LOBOS "La Bamba"39-36 PAUL KELLY "Darling It Hurts" 24-36 SAMMY HAGAR "Boys' Night Out"35-37 JON BUTCHER "Wishes" D-37 FLEETWOOD MAC "Little Lies"40-38 CROWDED HOUSE "World Where You..." 39-38 STEPPENWOLF "Hold On"25-39 INXS/J. BARNES "Good Times" 41-39 EUROPE "Carrie"28-40 FLEETWOOD MAC "Isn't It Midnight" D-40 EDDIE MONEY "We Should Be..."49-41 SAMMY HAGAR "Returning Home" 29-41 HEART "Who Will You..."37-42 EUROPE "Carrie" 47-42 THE CULT "Wild Flower"33-43 PRETENDERS "Where Has..." 50-43 DEF LEPPARD "Hysteria"31-44 CHARLIE DANIELS "Bogged Down In..." D-44 HOOTERS "Satellite"D-45 THE CULT "Wild Flower" 16-45 STARSHIP "Babylon"D-46 EDDIE MONEY "We Should Be..." D-46 WHITESNAKE "Is This Love"

44-47 WARREN ZEVON "Detox Mansion" 44-47 WARREN ZEVON "Detox Mansion"42-48 URGENT "I Can't Take It..." 46-48 THE BEARS "Fear Is Never..."48-49 STEPPENWOLF "Hold On" 30-49 CHARLIE DANIELS "Bogged Down In..."30-50 JOHN WAITE "These Times Are..." D-50 GLEN BURTNICK "Follow You"

"HOUSE OF TEARS"HEGE 11

New at 15 Stations!CONTACT SCOTT BORCHETTA: 615-242-1931

*N1

114.411rir46

MTMRECORDS

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (13)

THERD REPORT

TOP 60 Lp'sLw Tw1- 12- 25- 33- 44- 56- 6

11- 77- 88- 9

12-1010-119-12

15-1314-1413-1518-1619-1721-18D-19

17-2023-2130-2222-2329-2416-2527-2631-2728-2833-2924-3034-3120-3225-3337-3436-3544-3640-3726-3843-3941-4046-4135-4232-4339-4438-4550-4649-4751-4842-4947-50R-51

54-5255-5348-5453-5552-5645L57D-58

57-5960-60

ArtistGRATEFUL DEADDEF LEPPARDHOOTERSU2SAMMY HAGARWHITESNAKERICHARD MARXHEARTTOM PETTYBRYAN ADAMSCRUZADOSFLEETWOOD MACGREAT WHITEROGER WATERSJOE WALSHFAB T -BIRDSJON ASTLEYDAVID BOWIEINSIDERSLA BAMBA STBEAT FARMERSPAUL KELLYSTARSHIPTHE SILENCERSLOST BOYS STWARREN ZEVONLIVING/DAY STSUZANNE VEGADIOOUTFIELDEUROPE38 SPECIALPATTY SMYTHJON BUTCHERCROWDED HOUSEGLEN BURTNICKSTEPPENWOLFCHARLIE DANIELSPETE BARDENSOMAR/HOWLERSTHE CULTMASON RUFFNERTHE CALLMOTLEY CRUEJOHN WAITETHE CUREURGENTREPLACEMENTSNEIL YOUNGMARILLIONCUTTING CREWROGER DALTREYTHE BEARSTOM KIMMELJOHN HIATTDANNY WILSONTWISTED SISTERECHO/BUNNYMENROBERT VAUGHNBACK/BEACH ST

LOU IMPACT

Tracks"In The Dark""Hysteria""Long Way Home""The Joshua Tree""Sammy Hagar""Whitesnake""Richard Marx""Bad Animals""Let Me Up...""Into The Fire""After Dark""Tango In The...""Once Bitten""Radio K.A.O.S.""Got Any Gum?""Hot Number""Everyone Loves...""Never Let Me...""Ghost On The Beach""La Bamba ST""The Pursuit Of...""Gossip""No Protection""Painted Moon""Lost Boys ST""Sentimental Hygiene""The Living/Day ST""Solitude Standing""Dream Evil""Bangin"'"The Final Countdown""Flashback""Never Enough"'Wishes""'Crowded House""Heroes & Zeros""Rock And Roll...""Powder Keg""Seen One Earth""Hard Times In...""Electric""Gypsy Blood""Into The Woods""Girls, Girls...""Rover's Return""Kiss Me Kiss Me..."'Thinking Out...""Pleased To Meet...""Life""Clutching At...""Broadcast""Can't Wait To...""The Bears""5 To 1""Bring The Family""Danny Wilson""Love Is For...""The Game""Robert Vaughn/Shadows""Back To The..."

Radio Reports...

Monday and Tuesday

10am - 7pm EST

609-654-7272

NATIONAL REQUESTS

3-1 GREAT WHITE "Rock Me" 52KDJK, KFMX, KISS, KMOD, KQRS, WWZU, WZZO,KATP, KBAT, KBPI, KDKB, KEZE, KFMG, KFMQ,KILO, KJOT, KLAO, KMJX, FOODS, KRZO, KSJO,KSQY, UV), KWHL, KZOQ, WAPL, WBLM, WBYR,WFYV, WHCN, WHEB, WHMD, WKLS, WMRY, WRIK,WRXK, WTKX, WYNF, KGRO, KXRX, KZRR, WBAB,WCMF, WDVE, WIOT, WKQQ, WKOZ, WLNZ, WONE,WXLP, WZYC, WMAD.

1-2 WHITESNAKE "Here I Go Again" 38KFMX, KLAO, KMOD, WEBN, WFYV, WHMD, WIMZ,WMMR, WPLR, KATP, KFMF, KJOT, KRIX, KRZQ,WAAF, WAQX, WBAB, WBLM, WCMF, WDVE, WGLU,WHEB, WIBA, WIOT, WKLS, WKLT, WKQQ, WLNZ,WLZR, WMGM, WNPQ, WOUR, WPDH, WRQK, WWCK,WWCT, KQDS, WZYC.

4-3 JOHN COUGAR MELLENCAMP "Paper In Fire" 37KFMG, KLBJ, KMOD, KQRS, KSJO, KYYS, KZOQ,WEBN, WKGR, WMGM, WQMF, WWRX, WXRC, KFMF,KFOG, KICT, KMJX, KPEZ, KRIX, KSQY, KWHL,KWIC, KXRX, KZRR, WAAF, WDIZ, WEGR, WGTR,WIOT, WLZR, WMRY, WONE, WWTR, WXLP, WYNF,KGRQ, WGLU.

2-4 DEF LEPPARD "Women" 35KFMQ, KLAO, KNCN, KWHL, KZOO, WFYV, WWZU,KBAT, KEZE, KFMF, KFMX, KILO, KJOT, KLBJ,KMJX, KMOD, KQWB, KRQU, KRZQ, KWIC, WAAF,WAPL, WAQX, WHEB, WKLS, WKLT, WMGM, WRUF,IWTPA, WXRC, KBPI, KQDS, WIOT, WMMR, WZYC.

D-5 AEROSMITH "Dude (Looks Like A Lady)" 23WZZO, KAZY, KFMG, KICT, KLOL, KMJX, KQWB,KSJO, KTXO, KYYS, WAAF, WDIZ, WDVE, WGTR,WNEW, WRXK, WYNF, KPOI, KZRR, WAOR, WKDF,WKFM, WTPA.

6-6 JON ASTLEY "Jane's Getting Serious" 22KYYS, WHCN, WHMD, WKGR, WZZO, KBAT, KFMX,KOME, KQDS, KRIX, KTXQ, WDIZ, WGTR, WHTO,WKFM, WKLS, WKLT, WRUF, WTKX, KFMF, KTCL,WLNZ.

9-7 GRATEFUL DEAD "Hell In A Bucket" 19KLBJ, WAPL, WIZN, WMGM, WOUR, WPLR, KFMF,WDIZ, WMMR, WQMF, WRUF, WRXK, WTOS, KQWB,KRZQ, KW!, WAOR, WTKX, WKQQ.

7-9 LOS LOBOS "La Bamba" 16WHMD, WIMZ, WPDH, WWRX, WWZU, CHEZ, WBLM,WIBA, WKQZ, WONE, WWCK, WWTR, WZTA, KBAT,KGRQ, KZOQ.

10-10 EUROPE "Carrie" 13WAPL, WKDF, WPLR, WWZU, KNCN, KZRR, WHMD,WIOT, WXLP, KBAT, KICT, WGLU, WCMF,

5-10 GRATEFUL DEAD "Touch Of Grey" 13WIMZ, WPDH, CHEZ, KJOT, KOZZ, KTCL, KZRR,WHEB, WHTO, WKQZ, WONE, WWCK, WZXL

11-11 JON BUTCHER "Wishes" 10KEZE, KFMQ, KNCN, KWRC, WVRU, WHEB, WWCT,KDJK, KOZZ, WAOR.

8-12 HOOTERS "Johnny B" 8WMAD, KMJX, KRZQ, KWIC, WKLT, WMRY, WOUR,WZYC.

D-13 LOVERBOY "Notorious" 7KRQU, KAZY, KDJK, KPOI, WAAF, WGLU, WKDF.

D-13 U2 "Where The Streets Have..." 7KOZZ, WBYR, WWTR, WZXL, WRQK, WWCK, WZTA.

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (14)

THIRD REPORT INDUSTRIAL NOISE

New Age? I was good in the old one; I'll be great inthis one. And Harmonic Convergence did bringchange: I'm going back to radio. Soon, Jim Trappwill jump in and take it to the next level. Break a leg,Jim.

I love this business a lot. To excel at it, you've gotto know as much about it as you can; the more fieldsyou enter, the more knowledgeable you becomeabout the biz. I once asked J. Geils whether I shouldplay rhythm or lead guitar. He was right when he said,"Play it all, play it all..."

This has been an outstanding experience.In the past year here at the HR, I've met people of

awesome capability in radio, records and print --people I'd have never met had I not been RadioEditor here. What a turn -on it was to see that therewere people in small towns or on the local level whoare going to someday knock this business on its ass.

ALWAYS GO FOR IT. Opportunity knocks rarely inthis business. When it happens, grab it. If it doesn'thappen, make it happen. If I were a young PD, I'd bebusting my ass to meet and talk with Kendall,Logan, Utz, Wise, Oedie, Owens, Solk, Brown,Cody or Evans so I could make an impression onthem. Not Just because they know where all the goodjobs are (they always get offered them first), butbecause they are decent people who love radio andhave a genuine like for and interest in who the nextwave is. Training with a Master can shave years off ofladder climbing in this business; but we are talkingabout busy people and it's on you to find a way tosuccessfully approach them.

I relish calls with JB, Brad, Rapp, Tusken,McKeon, Moser, Beth, Lenny, Winward,Hock, Garrity, Dannheisser, Danny andSiCUreZZa not just because I go back all eighteenyears with some of them, but because their quest forknowledge about radio never ceased. They pursueexcellence.

If you don't like the news you read in this paper, goout and make your own. New, young people in thisbiz exist to build fires under dinosaurs. Hell, that's thenatural order of a youth -oriented, progressivebusiness.

And now a word from us dinosaurs: We can stilltake your best shot -- and then make you wake updead.

And you thought Life was a game by MiltonBradley.

In this business, people throw compliments aroundlike manhole covers, so I'm honored that you readthis column as closely as you did. That people ofimmense talent got off on this column knocks me out.And that you called or wrote was flattering andhumbling at the same time.

A year ago, I needed to be out of radio. Coming offa station that had three general managers, twoprogram directors, and four discernible formats ineighteen months, I felt as if I had played theNightmare Season in San Diego. Radio was definitelyin the butt, Bob.

Bill was there for me.He had just been slam-dunked, too. With Collie's

urging, he invited me in on the HR, and I'll neverforget the both of them for it. The great part was thatour relationship of ten years grew as we learned todeal with each other in a place of business. Whenyou're in the business as long as he and I, you don'tget to the places we got unless you're a meat -eater.We learned to put that aspect of life aside and ourpersonal relationship developed into the basics oftaking each other on face -value, with concern and

consideration for the other. And les' not forget to bementionin' power -belching, endless one-liners and aseries of practical jokes that are an integral part ofthe HR.

The paper speaks for itself. It is succeeding, and itdeserves to.

It is no mistake that this publication is more fun toread than the others. All of us got into this bizbecause it's fun. The HR never loses sight of thisfact.

This paragraph is going to look as if I added it atthe last minute; I didn't, If you've moved a lot (andwho hasn't), you know how tough it is to say goodbyeto the people you've worked with. You always do itlast because it's so difficult to do. Dawn, Eric, andAmy are good friends and Office Gods andGoddesses. No matter what hysterical insult washurled around the office, these people could top it thenext day. Dialogue was so outrageous, the placecould blow "Newhart" off the dial in the Nielsens. I

am going to miss seeing them every day.

Beat it, just beat it. The Beat Farmers recentlydropped by to harass the staff of KGB whilecultivating relationships in the field. Left to right: JoeyHarris, MD Pam Edwards, Country Dick Montana,Promotion Director Scott Chatfield, Jerry Raney andRollie Love.

Marshall Crenshaw shows the WDHA gang the PeterTownshend imitation that made him what he is today.Agape with amazement are WB's Valarie Goodman,Mike Boyle, Marshall and DJ Cat Carchia.

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (15)

ROCKIN' TO\ THE COREWHITESNAKE

"Is This Love"Coin' for a third Top 10 AOR smash!

New at KRQR WDVE KLOL KOZZ WDIZ WKLS WNEW WRXK

Already rockin' KAZY KBPI KGB KISS WLLZ WYNF KLOS WRIF

KATT KDKB KLBJ KRQU WZZO KBER KRZQ WBYR WLNZ WPYXand many more.

"Whitesnake is three for three at WDVE and 'Is This Love' showcasesDavid Coverdale's vocal range. It's been a while since I've heard sucri abeautiful rock ballad. . ." ANTHONY ALFONSI, WDVE

YET"Temptation"

Delivering another format exclusive!Now at KOME KISS KSJO KILO KRQR KRXQ WKLS WQFM WYNF

KNAC KBPI WBYR WLLZ WDHA WFYV KBER KWICNow at 16 stations this week

And don't miss a Contagious Tour.. .

°`.. .I'm still talking about it. This band is amust to see live in concert. Y&T is definitelyon the horizon." DALE MILLER, KATP

Now at KISS

DUNSPrIQP'Q

"Welcome To The Jungle"KQRS KRZQ KTXQ KKDJ WBCN WNOR

KATP

KNCN KRXQ

KEZE KILO KDKB KMBY KATP KLAQ WTOS KJOT WKWQ WNPQand more!

"Guns N' Roses is an act with a huge groundswellof interest. . . Already response from the

record stores and solid early phones."ALAN WHITE, KILO

Debut 99*Hard Hundred

GEFFENRECORDS

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (16)

PaRD REPORT INDUSTRIAL NOISE

Let's all have another Moussehead. The worlds ofKISW and the Hooters collided back stage after theband opened for Bryan Adams in the Seattle Center.Left to right, since nearly everything in Westerncivilization goes that way: KISW's Meg Noren, HootsRob Hyman, John Lilley, Andy King, David

ONE MAN'S CASTLEThe guy who got so much ink as the

WRXL/Richmond PD leader is in the headlines again -- but with different geography.

As we go to press, former WEGR/Memphis PDHowie Castle is in Orlando at WHTQ at the behestof owner T -K.

We know that Charlie Kendall wanted someone withexperience and, in continuing WHTQ's Adultapproach, doesn't want to turn the PD's office into aday-care center. Howie meets both criteria. Make nomistake, here is the leading candidate.

So what about Richmond? Jungle drum beat andsay "Harve Alan, Harve Alan..."

KOJAN THE BARBARIANGuess what name keeps popping up in the Steve

Feinstein replacement derby? If you took our adviceand whited -out the beard on the Steve caricatureR&R ran over the AOR column, you know the personabout which we're talking.

Another name that floats to the top, but not asoften, is ex-KZEW PD Rob Barnett.

Anyway, we've decided to help our colleagues at"The Industry's Newspaper." Simply paste the pictureof the person you think should become AOR Editor atR&R in the frame below and send it to: Bob Wilson,1930 Century Park West, Los Angeles, CA 90067.

52 is R&R

AOR

Uosikkinen, Eric Bazilian, and KISW DJ and VirginalRestoration spokesperson Carla Steele. They've gotlegs and they know how to use them: Columbia'sLarry Reymann, MD Mike Jones, Promortlon DirectorJulie Bradford and the station's Sue Hobbs andCoreen Freeman.

ANOTHER HOME SOLD BY CENTURY 21WIBA/Madison changed hands this week. Brand

new owners LL Broadcasting Inc. brought brand newconsultant Fred Jacobs in, displacing Frank Felix.

PD Jack Mitchell celebrated all of these changeswith life's biggest change -- no, he didn't fly toCopenhagen for the operation -- he got married.Congrats to Jack and bride Elaine Felder.

GOOD SCHMIDTAfter being National Promotion Manager at its Open

Air subsidiary, Rich Schmidt Is now Windham Hill'sDirector of National Promotion.

Schmidt also has stints with Rhino and UpstartManagement. He reports to VP/Marketing LarryHayes.

ADVENTURE IN MOVINGAfternooner/MD Steve Avery WOOJ/Ft. Myers is

out. Find him at 813-574-4092. Rumors, dey be flyin'that the place Is going Classic.

Wade Linder and KODS/Duluth are no more. Thestation Is looking for an MD who can do air and be athome In the production room. T&R to: Mike Keller,KQDS, PO Box 16167, Duluth, MN 55816.

Michael Krumper joins A&M as East CoastDirector of Publicity.

New PD at WHMD/Hammond is Timothy B.Munson. Steve Chavin remains OM. They need amorning show yesterday. How unlike a radio station...Send T&R to: Tim Munson, WHMD, 200 E. Thames,Hammond, LA 70403.

Ex-KZEW PD Dennis Andersen available at 214-750-8919.

WVVV is looking for a graveyarder. Beautifullocation, low cost of living. T&R to: Paula Coleman,PO Box 30, Christiansburg, VA 240073.

Our deepest sympathy to KBPI morning man JR.His dad was on that Northwest DC -9 In Detroit lastweek.

STEVE SUTTON

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (17)

IN THE GREAT TRADITION OFrw_r-

FROM THEFORTHCOMING LP

H 0 L D Y 0 U R FIRE(832 464.1)

On Mercury Compact Discs, Cassettes and RecordsProduced by Peter Collins and Rush

Management by Ray Donniels, SRO, Toronto

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (18)

71-'11111RD REPORT INDUSTRIAL NOISE

Ever -closer to a real studio through listener pledgesand Clint Culp's scorching play on the back nine at ahundred dollars a hole, KTXQ's Dusty "Redbeard" Hilljumped out of the Eliminator coupe long enough to

Joe Satriani backstage with fellow guitar whiz andformer pupil Steve Vai after the NAMM showcase gigin Chicago. The notes flew like sharpnel.

have dialogue with Billy Duffy and Ian Astbury of TheCult and fellow Texan Joe Ely, yawl. Gazingapprovingly are two members of Q102's new targetaudience.

Celebrating the kick off of MCA Radio's "A Touch ofJazz" are MCA's Mike Fischer, Bill Barnett, AlisonSteele, Bob Kardashian, Lance Robbins, and BobO'Connor.

Later that same column, KISW took two listeners backto meet Bryan Adams and shmooze the deli tray. Left

to right: MD Mike Jones, Bryan, Promotions DirectorJulie Bradford, and winners.

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (19)

MR. M STER"SOMETHING REAL"

A MOST ADDED SONG/ NEW AT 26 STATIONS"I was surprised with the Mr. Mister song. They decided to go a little more uptempo, with avery listenable melody and a good hook !" STEPHEN PAGE, KOME

No problem gentlemen, I knew that your talent was no fluke and "Something Real" continuesthe story. I love the kickoff beat and the infectious vocals that kept me listening."

PAM BROOKS, WPDHMR MISTER

sor.tbio, ray/ (tondo owtrtol.I.

Already on at over 110 HardReporters IncludingWSHE WRIF WCKW WNEW WIYY WKDF

WHJY WLLZ KYYS KSHE KRQR KSJOKGB KOME WKQQ WZEW WDIZ KRZQ

WWCK WRCN KRQU WPLR KMOD KBPI

31* Hard Hundred

WKLS

KBCOWNORKEZO

STAESh'El IP`BABYLON'

Making moves on asurefire tune

70-56* Hard Hundred

New! WDVE WKLS KLOLWLNZ WLZR WRQK KDKBWTKX KSQY WVVV WWTR

and more!"Starship has a super follow-up! It's great tohear Grace back up front in the band."

Rick Van Gil, WLNZ

"It's my favorite song from thealbum!" Anthony Alfonsi, WDVE

TSILENCERS'PAINTED MOON'AN AOR BREAKTHROUGH!

Would you believe 130+stations on? It's true!

26* Hard Hundred

Medium to Heavy-

Still building atKBCO KGB K LO L

KSHE KSJO KRQR

KFOG KROQWHJY WLIRWMMRWKDFWEBN

ANDTONSMORE

461aV

WXRTKOMEWIYYKZAP

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (20)

THEHARD REPORT

ONVEZALTERNATIVEstill a question mark in some minds. A future singlescompilation is in the works to clarify but for now, seeif you can get the message already on at WRVU,WTOS, WWVU, KCMU, KRCK, WBNY and WXCI.Contact Thirsty Ear: 212-697-7800.

* ' PROGRAMMER PICK *

Mark Greenland, WWUH, W. Hartford

SWING OUT SISTER "IT'S BETTER TOTRAVEL" (MERCURY/PG) This act fromEngland's mew music invasion was brought to theU.S. by a transformation of independent U.K. buzzto major label distribution. It's not a trendy album,there's no hype, but the music is distinct andsophisticated. I find it fascinating that SOS will beestablished as a college phenomenon beforemoving on to commercial recognition. Their musicis geared more toward a jazz or AC oriented mind.Their debut album displays diversity ranging from"Blue Mood", an uptempo dance oriented piece tothe big band sound of "Breakout". An olderaudience can definitely relate to their material. Onething I have to say about all the songs is that theyreally compliment Corinne Drewery's beautiful voicewhich is a real focal point, especially in "TwilightWorld". It's a moody drifting piece that shouldappeal to those who prefer sounds of soul. This isa record that works in any format, on any dancefloor, in a any scene!

CHARTSTARSDUMPTRUCK "GOING NOWHERE" (BIGTIME)16 stations jump OTB for the new single, featuringupbeat irresistible guitars that catch ears at KJET,WEQX, WTOS, KFMH, KTCL, WFNX, WHFS, WHTG,WMDK, WOXY, WRAS, WRVU and more. It's new at50* and tied with the Cars for New Alternative action,and that's sayin' a mouthful. The new Lp, "For TheCountry" is close at hand, but quick action on thesingle opens up greater propects for the band on acommercial level. Stay tuned.

dB'S "THE SOUND OF MUSIC" (IRS)A 42-21* airplay sprint means the dB's are thebiggest movers this week as new action on albumcuts and positives for "I Lie" start to pour in. Thesingle is at WHTG, WNCS, KATP, KPEZ, KRCK,WEQX, WFNX, WTOS, WHFS, WZEW and more Lpmentions from WRAS, KBCO, KEYX, WMDK, WXRTand WBNY. Howard Glassman at WEQX plugs, "I'llturn my attention to the dB's. Catchy witty rock androll. You can pump the living piss outta R.E.M., butgive the dB's the same recognition because theydeserve it. They've been doing it just as long andjust as well." Other tracks of mention include"Change With The Changin' Times" (WHTG's MikeMarrone says its "incredible"), and "Working ForSomebody Else".

WILD FLOWERS "DUST" (BIG TIME)This band has pizazz and first hand experience tellsme that it comes across very well on the air. "A KindOf Kingdom" can be heard at WEQX, WTOS, KEYX,WHFS and more, like WRAS, KRCK, KTCL, WBNY,WRVU, KUSF, WWVU, WWUH, WOXY, WXCI, KEYX,KJET and WGTU. It's been said there's not a badtrack on the Lp and tracks like "Where My Heart Lies"and "No Surprise" are hits in disguise. New at 43*.ECHO AND THE BUNNYMEN (SIRE)/ NEWORDER (QWEST) As these fine bands launch anAmerican tour with Gene Loves Jezebel, you can betour Comments pages will be filled with reactionarywords (see Paul Kriegler, KRCK). Enough of the tourde force, there are great records to be played! Thenew Echo single, "Lips Like Sugar", will be the trackto breakthrough a mainstream wall as new addsinclude WFNX, WXXP, KEYX, KFMH, WIOQ, WWZU,KZEL and WHEB. And with 90% of the alternative onor about to be, this record looks to be a #1 airplayalbum soon.... "1963" is backing "True Faith" for newemphasis on New Order's "Substance" Lp - and don'toverlook two special re -recordings as well. Moving to11* this week thanks to WHTG, WLIR, CFNY, KJET,KEYX, WTOS, WXXP, WHFS, WRAS, WKXL, KRCK andWFNX.... Gene Loves Jezebel's new one "Suspicion"gets the nod before Geffen releases an official singlein two weeks. Ivar Hamilton, CFNY says, "It's my firstpriority record this week, and their strongest since'Desire' for crossover potential."DEAD MILKMEN "BUCKY FELLINI" (ENIGMA)In top 5 request status at alternative stations whoanswer the phones, "Instant Club Hit" proves thataudiences want to have fun, and they can't getenough of this band. Name another track - I dare ya!It's "Big Time Operator", and the 12" is out now. Putit next to your Mojo record and it'll put you in a goodmood. Susan Kennedy at WWVU says, "It's reallyselling here. The band has a lot of fans and everytown has their faves - well our audience knew assoon as this one hit the street."

More news that fits...next week! -Dawn Hood

TRACKS3- 1 BEAT FARMERS "Dark Light"

D- 2 THE CARS "You Are The Girl"

2- 3 ECHO/BUNNYMEN "New Direction"

4- 4 PAUL KELLY "Darling It Hurts"

5- 5 THE CURE "Just Like Heaven"

1- 6 SILENCERS "Painted Moon"

7- 7 J.C. MELLENCAMP "Paper In Fire"

6- 8 NEW ORDER 'True Faith"

D- 9 PRETENDERS 'Where Has Everybody Gone"

D-10 DAVID BOWIE "Never Let Me Down"

13-11 SUZANNE VEGA "Solitude Standing"

10-12 REPLACEMENTS "Alex Chilton"

8-13 U2 "Spanish Eyes"

9-14 JESUS/MARY CHAIN "April Skies"

11-15 GO BETWEENS "Right Here"

12-16 CRUZADOS "Bed Of Lies"

14-17 HOOTERS "Johnny B"

16-18 LOS LOBOS "La Bamba"

20-19 NEW MODEL ARMY 'White Coats"

19-20 10,000 MANIACS "Peace Train"

Most Added Bubbling Under Top 5 Indie Label Picks

#1 The Cars (Elektra)#1 Dumptruck (Big Time)#2 Tom Waits (Island)#3 dB's (I.R.S)#4 Dukes Of Stratosphear (Geffen)

Pete Wylie (Virgin)Belouis Some (Capitol)ABC (PolyGram)Buckwheat Zydeco (Island)Tom Waits (Island) #5 Sonic Youth 4.SST)Curiosity Killed/Cat (PGram)

#1 Dead Milkmen (Enigma)#2 Brandos (Relativity)#3 Wild Flowers (Big Time)#4 Go Betweens (Big Time)

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (21)

FABULOUSTHUNDERBIRDS

"HOW DO YOU SPELL LOVE"produced by Dave Edmunds

32-24* Hard Hundred33-28* R&R Backpage

Breaker!Rollin'

WDVE WKLS WQFM WHEW WNORKSHE KYYS KGB KXRX KLOL

plus well over 100 more.. .

New Video, CSN Tourand immediate phones!

EUROPE"Carrie"

33* Hard Hundred31* R&R Tracks31* Album Impact26* R&R Albums

Major WIYY WBAB WKLSWYNF WLAV KLOSKUPD KOME KGBad infinitum.

38-27* R&R CHRThere are noexcuses left.Go ahead,call Garrett.We dare ya!

CBS ASSOCIATED

INSIDERS"Ghost OnThe Beach"24-17* Hard Hundred22-17* R&R Tracks

Closed WBAB WMMRWKLS WYNFWLUP KQRSKSHE KLOSKISW KGBplus 140 more!

Hip Clip - airsapproximatelyonce everythree hours!

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (22)

THERD REPORT INTERVIEW

Is back with his ninth album, and he's singing a different song.His first A&M release, "Bring The Family, marks a stage in hiscareer that speaks with honesty, and hope for the future, lyricsbrought to life by a blue ribbon cast of players. In a mere 4 days,John Hiatt, Ry Cooder, Jim Keltner, Nick Lowe and producerJohn Chelew recorded an album that's gaining notice amongthe year's best. A blend of roots rock, blues ballads and whole-lotta-soul vocals, "Bring The Family" is about as genuine as theycome - but John could tell you that....

Dawn Hood: How was "Bring The Family" born?

John Hiatt: It came about literally overnight, or so it seems. Isat down with John Chelew at McCabes between shows, thefirst week in February when I had a standing offer to make arecord for Demon Records. I had no idea what type of recordto make - I had basically run out of ideas. John booked me atMcCabes for several years and had been giving a new album alot of thought. He had several definite ideas, even down to whoshould play on the record. We chatted for an hour or so and hewas adamant about doing it quickly, about getting Ry and JimKeltner, and a small but really great band together and goinginto the studio to record it fast. Doing it live was also a big partof his plan... The idea of have a new album finished in four daysreally appealed to me! From the point at which he brought theidea up to when we actually went into the studio was one week.

Dawn: How did you finally come to an agreement on whatsongs would be on the record?

John: John had been going through tapes of my live perfor-mances at McCabes. I use the club as a place to sing newmaterial and he had most of my new songs on tape dating backtwo years. The only 2 cents I threw in was that I wanted to keepthe album positive, hopeful and reflective of where I wasnow. I think we managed to do that.

Dawn: How much artistic freedom was granted to the players -especially in a four day session?

John: There were no boundaries set, we literally had to put ourmusic where our mouths were. There was no discussion on amusical level - the sessions were free form. We just played whatand how we felt.

Dawn: Does "Bring The Family show any similariities to yourearlier work?

John: It's a real departure in approach. Before, I tended to laborover details. There was a lot of overdubbing and I would alwaysfind myself redoing the vocals. On this album everything is live.I'm singing and playing with the band.... I'd like to think at thesame time it's a refining of the type of sound that I started to gofor around the "Riding With The King" period. We kind of madea left turn with the last album (but we were trying to get a recordplayed). It's a funny thing - once I was comfortable enough tolet go, finding myself in a situation which was one where I hadnothing to lose, there seemed to be a green light. In retrospectit was a real lesson. Just letting go...

Dawn: What do you consider your musical image to be?

John: Labels can be so misleading, but I realize the need forthem. That's a tough one, but I kind of see myself as a bluessinger. I don't mean in the "classic" sense because I'm not astudent of the blues per say. One singer who had a big influenceon me was Mississippi John Hurt. He was almost a folky typeof blues singer. I learned a lot from him in the sense that he laid

back and let a song pop out. There was a real sweet sentimentin his work even though he sang such tough words. My style allcomes down to folk music and I've used this analogy before,but even Prince to me is folk music. Music that has a ring, clarityand is connected to humanity and truth.

Dawn: Can you discuss the contrast in mood between theslower songs and the more upbeat material on the album?

John: We wanted the record to project an overall tone that thereis a light at the end of the tunnel. And it turns out that there aretwo sides to that story. I think it's necessary to look at the darkside of life (God knows we all go through it), because withoutbad days you don't have any good days. Joy as it turns out tobe in my experience, is a fleeting thing. Real toy is not what Ithought is was. I once thought joy was about being crazy, hypedup and flyin' (not necessarily drug induced). Happiness is foundin the little things. You get glimpses of it.

Dawn: What about the new single, "Thing Called Love"?

John: It's the strangest groove we've ever come up with. I don'tknow how we hit on that beat but I don't think I've ever heard itbefore! I don't want to stake out Bo Diddley territory in creatinggrooves, but we sure stumbled on to something - and I reallydig it.

Dawn: What is the song about?

John: It's kind of a wedding song, a little hard nosed I guess.The companion piece to it oddly enough, is "Learning How ToLove You", but they both deal with true love. "Thing Called Love"is sort of the question. A guy hedging his bet a little, asking thegirl if she's ready because they're headin' for the aisle!

Dawn: How did you develop your singing style?

John: The two biggest influences on my singing style wereElvis Presley and a radio station! When I was a kid I used to lis-ten to WLAC out of Nashville, Tennessee. It was a 50,000 wattclear channel R&B station in those days, and they played a lotof regional R&B records which I had never heard before. My biginfluence was a gospel show. The DJ's name was The Hoss Manand in fact, he may still work there. He used to play all blackgospel music, and being a white kid from the midwest, mychurch experience was very staid, and in a foreign language forChrist's sake! I'd hear these people singing and carrying on,gettin' so outside themselves and it was so exciting. It movedme so much...

Dawn: When did you first pick up a guitar?

John: When I was eleven. It was definitely due to Elvis Presley.You know, I'd spent two years in front of a mirror with a tennisracket pretending to be him! I was a kid from the midwest whostood in front of a mirror with a tennis racket who could'transform' himself into the King!

Dawn: What is your Demon Records connection?

John: Well my friend Andrew Lauder runs the label and I'veknown him since I met Elvis and Nick Lowe in the early 80's.He's a real fan of American music in fact, the bulk of the label'soutput is reissues. A batch of recent releases includes "There'sA Riot Goin' On" and "Fresh" from Sly Stone. Demon picks upwhat they consider to be classic American albums. They'rereleasing the whole Byrds catalog soon. It's a real interestinglabel, one where you can pick up a record and know that it willbe good music. That label identity - well you don't find much ofthat these days. I also thrilled to be on A&M. They're a differentbreed as far as major labels go. I've only met really great folks -I'm amazed by the organization.

Dawn: Who is touring with your?

John: I'm real proud of the band. They're from Louisiana -Sonny Landreth on slide guitar; Dave Ranson on bass and Ken-neth Blevins on drums. They came already assembled andthey're terrific! I'm thrilled to be working with them.[ed. Be sure to catch John on tour now!]

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (23)

SCILleeZe

yourdeskthis

week!

-cmx.RECORDS

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (24)

EHD REPORT

AIRPLAYLw Tw2- 10- 21- 33- 44- 5

21- 66- 75- 8

10- 98-109-11

11-1212-137-14

14-1520-16D-17

16-1813-1917-2018-2120-2215-23R-24D-25

19-26R-27

30-28D-29D-30

ArtistDEF LEPPARDAEROSMITHDIOGREAT WHITEGUNS N' ROSESHELIXFASTER puss*CATWHITESNAKEHEATHENHELLOWEENMOTLEY CRUEANTHRAXSAMMY HAGARACE FREHLEYTWISTED SISTERY&TPOISONKING DIAMONDWHITE LIONLOUDNESSTROUBLENUCLEAR ASSAULTGRIM REAPERCELTIC FROSTWASPSWORDPRETTY MAIDSSHOUTLIZZY BORDENLEIGE LORD

HARD ROCK/HEAVY METAL

Album/Track"Hysteria""Dude ""Dream Evil""Once Bitten""Appetite For...""Wild In The Streets""Faster puss*cat""Whitesnake""Breaking The Silence""Keeper Of The...""Girls, Girls...""Among The Living""Sammy Hagar""Frehley's Comet""Love Is For...""Contagious""I Won't Forget You" 12""Abigail""Pride""Hurricane Eyes""Run To The Light""The Plague""Rock You To...""Into The...""Scream Until..." 12""Metalized""Future World""Finger On The...""Visual Lies""Burn To My Touch"

MOST REQUESTED METAL1 ANTHRAX2 HELLOWEEN3 GUNS N' ROSES4 NUCLEAR ASSAULT5 HEATHEN

67 DEF LEPPARD8 ACE FREHLEY9 KING DIAMOND

10 WHITESNAKE

MOST ADDEDAEROSMITHWASPHELIXCELTIC FROSTHEATHEN

"Dude (Looks Like A Lady)""Scream Until You..." 12""Wild In The Streets""Into The Pandemonium""Breaking The Silence"

Poison, "I Won't Forget You",Enigma/Capitol.... After all of the success that thisband has enjoyed lately, we've got to believe this newballad will do at least as well.Everywhere except AOR, unfortunately. We've got astrong #17 Metal debut and you can bet on huge CHRaction. Frankly, I can't believe so many mainstreamprogrammers are blowing it. This song could be sucha winner for them. I mean, how many ballads do guysreally like?

W.A.S.P., "Scream Until You Like It",Capitol.... Okay so it's not "Animal (I F**k Like ABeast)", but it is the best thing that the band has putout since Blackie Lawless returned to the guitarscene (Randy Piper was the group's original guitaristbut he left the band just before the "Inside theElectric Circus" album. Replacing Piper was bassplayer Johnny Rod, formerly of King Kobra, thenBlackie switched to playing rhythm guitar.) It's alsothe theme to the soon to be released movie,"Ghoulies II" which, if you saw the original, isbasically about a modern day warlock who raises thespawn of Satan In miniature form. The song itself hasa good groove which is easy to get into. It almostmakes you want to get up and dance! Oh my god, I

don't know what just possessed me to say that!

RECORD OF THE WEEKAerosmith, "Dude (Looks Like A Lady)",Geffen.... Y'know, with all of the stuff coming outnow that sounds like classic material, it sure is goodto see the real thing "Back In The Saddle", so tospeak eh? It would seem that quite a few otherpeople think so too because the city of Boston iscertainly well represented this week. Checkit out! Animpressive debut on the Hard Hundred at #16 leadsto an unquestionably good start on the even Harderthirty at, no wait...bet you can't guess, how about #2?Surprised? I'm not. Just remember that this is theband that started that classic "Aerosmith Sound" thateverybody's been raving so much about recently.Raving so much in fact that it's also #2 most addedAOR and #1 most added metal this week with toomany reporting stations to list in this tiny space.Dude, it's hot!

Lizzy Borden, "Visual Lies", Enigma/MetalBlade....Magnificent!!! Whoa, talk about a shocker! I expected

some trademark off-the-wall really heavy-duty typestuff from these veteran L.A. metal gods, but what Igot was some really tasteful, and extremelycommercial heavy metal. You can tell that producerMax Norman has done his Job well. Be warned thatthis is not the trademark Lizzy that you've grown tolove ("American Metal", "Love You To Pieces", "LoveKills", Etc...). No, this is easily accessible materialfrom a great band. In fact this should be the one thatreally makes "Lizzy Borden" a household word.Murderess Metal makes its debut on our chart at #29this week but you can look for some upwardmovement very shortly. Tracks to check out include,"Me Against The World"(You know how everyoneloves that good old anthem rock stuff), "Den OfThieves", "Voyeur (I'm Watching You)", and the titlesong. Don't wimp out on this one. Give 'Em The Axe!(the fans that is.)

Helix, "Wild In The Streets", Capitol....Remember last week when I said that the albumwould be In those grubby little hands of yours verysoon. Well as you now know, I don't make Idlethreats. They made all three of our charts this week."Not one, not two, but three my lord." (Just a little bitof culture for the section. That's Shakespeare by theway. You know I just knew that course I took In HighSchool would come in handy someday!) They made aHUGE 21-6 jump on the metal airplay chart, came In#6 Most Requested Metal, and were #3 Most Added,All in one week! I like it! Can't wait to see what thefuture has in store? Tune in next week for all theanswers.

Heathen, "Breaking The Silence", Combat....Here's one that I really didn't expect. You'd think,judging from the single that this was just another inthe long string of bands that was really quite goodbut simply wasn't heavy enough to attract thathardcore audience. Well guess what, the albumcontains some of the best thrash I've heard sinceFlotsam and Jetsam's brilliant "Doomsday For TheDeceiver" LP. The guitarwork seriously kicks ass asdoes the drumming. It's almost enough to make onethink that these guys sold out on "Set Me Free" in abig way, but that song is really quite a refreshingchange of pace and is rather unexpected from athrash band of this high caliber.

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (25)

THEHARD REPORT

HARD ROCK/METAL

Y&T, "Contagious", Geffen.... Looky here at thisnow. For the second week in a row these boys aregoing up our chart. How about 20-16*??!! I have astrange feeling that the single might have hadsomething to do with the move. "Temptation" debutedat #82 on the Hard Hundred this week, you know. I

think that I can deal with that, how 'bout you?Anyway, I'm sure that you guys know by now thatthere are more than two songs on this album worthyof airplay. Try "Armed And Dangerous", or maybe"Bodily Harm". Let me tell you that this album isaptly named to say the least because these songs arespreading like wildfire and, thank goodness, there'sno cure!

CHRIS BLACK -- METAL COORDINATORJEFF LUTTRELL -- METAL SLAVE

METAL NEWSI recently attended a Whitesnake/Motley Crue show atthe Meadowlands Arena in East Rutherford, NewJersey. Whitesnake was incredible. Unfortunately, dueto circ*mstances beyond my control, I was not ableto see any of Motley Crue's set. But, in talking to allthe members of Whitesnake I learned many thingsabout how the band got together and where they aregoing. First, Rudy Sarzo will be staying with the band.For quite some time now, rumors have beencirculating that he was returning to Quiet Riot andthen that he wasn't. Well, according to Sarzo himself,"This is an opportunity that I can't pass up. I wouldbe stupid to leave this band at this point". Next, I

spoke to Vivian Campbell regarding his exodus fromDio. According to Campbell, it had nothing to do withhis playing. It was apparently a personality clashbetween Campbell and Ronne James Dio. Later, itspread to him also clashing with manager Wendy Dio.The problems allegedly started several months afterCampbell joined the band. But he stuck with itthinking that the situation could be patched up. Whenhe realized it could not be, he left. Now, saysCampbell, he is as happy as he has been in a longtime. Does he have any animosity towards the Dio's?He claims he does not. He does thank Ronnie forkeeping his name in the press. Finally, it is thisreporter's opinion that Whitesnake, provided this line-up can stay together, will be a band that will dominateheavy metal for many years to come. Aside fromAC/DC (the Bon Scott era) and Aerosmith, no oneplays the blues better than Whitesnake.

I realized that there were many parents inattendance at the Meadowlands show along with theirkids. I took the opportunity to speak to approximatelya dozen parents. I asked them, in light of the recentlawsuit being brought against Motley Crue by amother who suffered ear damage when sheaccompanied her daughter to a Crue show, did theirchildren prepare them for what was going to happentonight? Did they explain that there would possibly beprofanity, the music would be loud, and that therewould be sexual innuendos? 75% of the parents I

spoke with said that they were aware. I also askedthem if they would have still accompanied theirchildren had a women named Tipper Gore not comeout of the woodwork? It surprised me that 60% saidthey would still have accompanied their kids.Impressive, isn't it?

As promised in our previous issue, we have morenews regarding the commencement of Motorhead'sacting career. The film is called "Eat The Rich". It wascreated by the British troupe, The Comic Strip. In themovie, Lemmy stars as a Russian spy and a drugdealer named Spider. The other band members,Wurzel, Phil Campbell and Philthy "Animal" Taylor,

also will be appearing in the movie but only in cameoroles. Also appearing in cameo roles are Paul andLinda McCartney, Koo Stark, Bill Wyman (RollingStones) and Jools Holland (Squeeze). Motorhead willbe doing the title track for the movie which will alsobe included in the upcoming new Lp, "Rock 'N' Roll".Wonder if "Miami Vice" is looking for more celebritiesto make guest appearances?

Hooray for W.A.S.P.!!! Taking the saying,"Turnabout is fair play", to heart, W.A.S.P. may besuing Tipper Gore, the co-founder of the Parent'sMusic Resource Center (PMRC) for infringement ofcopyright laws. Apparently, Ms. Gore used the albumcover of a W.A.S.P. album in her book, "Raising PGKids In An X -Rated Society", without the permissionof the nand. The band feels that Ms. Gore's book isbeing used against them. (Ms. Gore's husband,Senator Albert Gore, is currently making a run for thepresidency of the United States). According to JensenCommunications (W.A.S.P.'s publicity firm), BlackieLawless wrote Ms. Gore to express his displeasure.He's asked for one of two things from Ms. Gore. Hewould like either a formal written letter of apology ora $50.000 donation to a charity chosen by W.A.S.P.The press release also claims that W.A.S.P. does notwant any publicity. All they want is an end to all theharassment and abuse by Ms. Gore and the PMRC.This reporter wholehearted endorses the effort beingmade by W.A.S.P. to end the harassment and abuse.Good luck Blackie. I know you have the support of allmetal -heads around the world.

In other W.A.S.P. news, they are going to appearon two upcoming soundtracks. First, the band willperform the theme song to "Ghoulies" appropriatelyentitled "Ghoulies II". The song is called "ScreamUntil You Like It". The 12" will also feature two neverbefore released tunes. They are: a live version of"Shoot From The Hip" and an acoustic version of"Sleeping In The Fire". The band will also shoot avideo for "Scream Until You Like It". It will be

produced by Glenn Goodwin & Associates, who areresponsible for Lionel Ritchie's "Dancing On TheCeiling" and it was directed by Dave Gladstone in hisdirectorial debut. The other soundtrack is for themovie "Dudes". The band will have their song "ShowNo Mercy", which was the B -Side to their infamous"Animal (F*ck Like A Beast)", featured on thatsoundtrack. The lead song from this film comescourtesy of Keel. It is a cover of Australia's RoseTattoo's "Rock And Roll Outlaw". The band has alsorecorded a video for the song. Also to be featured onthe "Dudes" soundtrack is a remixed version ofMegadeth's "These Boots". The song was originallyfeatured on Megadeth's "Killing Is My Business... AndBusiness Is Good" Lp. Seems like "River's Edge" hasstarted some sort of trend amongst soundtracks.

In their continuing series of compilation albums,New Renaissance Records have released "SpeedMetal Hell 3" and "Thrash Metal Attack". Both ofthese feature music by bands in their demo stages.Many of the bands that have appeared in this serieshave gone on to sign deals either with NewRenaissance or other metal labels both major andindependent. Some of them include: At War (Virginia),Anvil Bitch (Philadelphia), Flotsam and Jetsam(Arizona) who are now signed to Elektra Records,Savage Grace who signed to Metal Blade, Attila (LongIsland) who went on to sign to Shatter Records andWhiplash (New Jersey) which signed on withRoadracer Records. Bands that will be featured on"SMH 3" and "TMA" include Blood Feast, DreamDeath, Desexult, and Necrophagia".

Just make sure your sheet metaldoesn't become scrap metal. Until next time, here'sMUYA from the heart of Queens. -Sal Treppedi

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (26)

THERD REPORT

INTERVIEW

WHITE LION INTERVIEWIn the new world of hard rock, we are witnessing more blendsof harmonic sounds with the regular staple of thundering rockriffs. Because of this we're seeing bands with new versatility,creative energy and songwriters with more room to grow andexplore. One band that is right in the middle of this is White Lion.Formed in 1984, they have had two releases "Fight To Survive"(which did very well as an import) and "Pride" on AtlanticRecords which is opening the band up to a much wideraudience. The bands members are Vito Bratta, Mike Tramp,James Lomenzo, and Greg D'Angelo. Ihad a chance to speak with lead guitaristVito Bratta for some insight on a newband that is definitely on it's way to thetop.

Chris: Vito, can you give our readers a lit-tle background as to how the White Lioncame together and got its start.

Vito: Okay, well I was in a copy bandaround here called Dreamer, this is about1982, and Mike (Tramp) was in a bandcalled Lion, they used to be called Mabelin Europe, but they changed their nameto Lion when they came over to play. Heopened up for me at L'Amour, and thatwas in November of '82, and basically wejust kind of met back stage. He went backto Europe and both our bands broke upabout the same time so he came backhere in April of '83, and called me up andwe started the band. The first thing we didwas write "Broken Hearted" together, andthen we approached managers and theysigned us and got us the producer and we were all set to got toGermany. So we got the band together which at the time wasNicky Caposi on drums and Felix Robertson on bass. And wedid the album in February of '84, came back and we got signedin June of '84 to Elektra/Asylum.

Chris: Oh, you were actually signed to Elektra?

Vito: Yeah, we were but they never released it. They never gaveus a reason. They gave us an eight year/eight album deal, tonsof money, video budgets and everything and then in Novemberof '84 they decided not to put it out. So most of 1985 was spentdoing nothing uh well we did "Web Of Desire" for the movie

from"The Money Pit", if you know about that. In the beginnin of '86Victor Records licensed the record (Fight To Survive)Elektra...see Elektra wouldn't sell it to any other major labels,but since Japan was out of the country they licensed it to them.But it did so well as an import that Grand Slam here in the statesgot on it.

Chris: That record was number one on "Kerrang's" importcharts.

Vito: Right. Well, I get confused with all that labeling, to some-one who's into light music we're a heavy metal band, and to kidsthat are heavy metal we're definitely light.

Chris: Well is there anything that you feel really sets you apartfrom all the other bands, new and old, that are out there?

Vito: Well, just the variety. I mean we don't get just that one beatthat works and then use a whole album of it. We like every songto be different.

WHITE LION

PRIDE

Vito: Yeah! It did really good, and that was basically it for '86with "Fight To Survive" doing what it had to do and us writingnew songs. Then we signed with Atlantic in February of '87.

Chris: There are a lot of different types of musical styles on thisrecord, is that due to your guitar influences?

Vito: When I was a kid I was really into Led Zeppelin, and that'swhat I liked about them...every song was like it could have beena different band. So it always kept you interested. And I justdidn't want to put out an album of all the same songs. I wantedto go from blues to heavy to ballads, to whatever. A song is asong, I mean if you're gonna put out an album of all the samesongs it should be like a concept album where it all fits intoplace. But I just want everything to be different.

Chris: When you write do you have a target audience?

Vito: No, not at all we really just write for ourselves. Like anyonewho heard "Fight To Survive" might say that "Pride" is a littlemore commercial but it's three years later, we didn't do it ust tosell records. It's hard to explain to kids cause they're gonnathink 'okay they're on Atlantic now so they went more commer-cial, but its not true at all it's just the way we write.

Chris: In terms of potential sales, how do you feel about beingput into the classification "Hard Rock" or "Heavy Metal"? Doesthat limit your audience? Because a lot of newer rock bands aremore crossover. You guys obviously have mainstream poten-tial.

Chris: Do the comparisons to other bands(Bon Jovi, Tesla) hurt or help?

Vito: Well, there's always gonna be a com-parison to someone... I don't think it couldhurt. I mean if we can get compared toBon Jovi when the guy has sold eight mil-lion records... It's weird really because Idon't hear any Bon Jovi, similarities andall it's just...you're commercial, and it'sheavy and right away it's Bon Jovi.

Chris: Are you one of those bands thatprefer live performance to studio work?

Vito: Oh definitely. I don't think manybands really enjoy the studio that much. Itreally gets crazy inside that one room allthe time.

Chris: Any live performances that wereespecially memorable for you?

Vito: I'd say that so far, well we reallyhaven't been able to do too much touringunless you're on a major label. But with"Pride" we got to do the Ace Frehley tour

- the first half of it from June 20th to July 25th, but I'd say thatso far the highlight of the band's live performance has beendates we did with Triumph at the end of last year. 'Cause theywere arena shows and it was the first time we got to play soldout arenas.

Chris: You've managed a really tight sound in a relatively shortperiod of time. Let's see there's James Lomenzo on bass andGreg D'Angelo on drums. They're fairly new to the band.

Vito: Yeah, Greg was just a local drummer, he's from Queens,and he used to be in Anthrax and Cities.We just put an ad in thepaper, auditioned about a hundred drummers and we foundhim. And James was in a band - Rondinelli, out of Long Island,but he gave that up and went to California and that's where wefound him. It came together really fast, I mean the band the wayit is now has only been together about a year.

Chris: You sound real great, how about you're musical in-fluences as a guitarist? I d read somewhere that you list AlDimeola and Segovia as two of them. That's pretty intensive.

Vito: Yeah well, things have changed (laughs). Right now, andsee I always hate saying this but I only listen right now to clas-sical music. And I hate saying that only for the reason thatpeople like Yngwie are doing these articles and saying "yeahlike I listen to classical music" so every guitar player is runningout and buying classical tapes... I don't want to make myselfsound like that but the truth is that's what I really listen to. Myinfluences were Van Halen and I like Stevie Ray Vaughan. Butmaybe the two major ones have always been ...Jimmy Page inthe beginning when I was a kid and Eddie Van Halen wasprobably the biggest.

Chris: Well, again there have been a lot of comparisons drawnbetween the two of you. Especially as far as speed and techni-que are concerned.

Vito: Yeah sometimes you know people ask me does it get an-noying... like in the new Kerrang they put down in print that I'mbetter than him and stuff, but I mean any comparison... youknow when your getting compared to the BEST...it's not likethey're turning around and saying "oh he's just like the guitarplayer in " well I shouldn t name a band but, consider-ing Van Halen's been considered the world's greatest rockguitarist technically whether he is or not I don't mind it... anytime you do any of that finger tapping or anything right away...

Chris: Do you think that the classical influence is becomingmore acceptable in hard rock music and understood, becauselike you mentioned about Yngwie he has sort of opened up thedoors to it?

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (27)

HARD REPORT INTERVIEWVito: Yeah, and it's really funny because that whole thing withhim... I mean he's a great guitarist and everything, but they keepsaying this thing about "classical rock" but ten or fifteen yearsago ELP was doing it and if any one remembers in the earlyseventies, and I only remember it as a kid I mean I was only tenor eleven, I remember people saying there's classical rock stuffcoming out of England. And as far as styles or that kind of guitarplaying if anybody buys an Al Dirneola record they'll hearYngwie. Only ten years ago. Only thing with Yngwie is that he'sa young kid with long hair growing up with a Strat and a Mar-shall and doing it you know and that's what brought it to theyounger audiences. I really don't pay that much attention to theclassical heavy rock stuff, I mean not nowat the moment.

Chris: Well, that just gets back to the wholelabeling bit too... it's all really dependent onthe style you choose to play.

Vito: Uh huh, If you really listen to true clas-sical music you'll see that it really has noth-ing to do with what these people are doing.Which is good because they're not copy-ing it exactly, they're just taking it and doingwhatever they want with it. The only badthing is that people, when they're thinkingclassical guitar they are thinking Yngwvie.Which is really the furthest thing away fromit. But at least he's getting it to them. Whichis good.

Chris: Well, there will be guitarists listeningto your record...songs like "Lady Of TheValley" and hearing the acoustic partswhich is good because crunch guitar ns welland fine but it's good to see some ver-satility...

Vito: Yeah, really you can never sound heavy unless you havea contrast, I mean it's like having daytime outside all the time,you wouldn't know it's daytime without the night. (laughs) I

mean how's a guitar really gonna sound heavy, it's got to becompared to something. I like that in the song where it just goesinto an acoustic and then comes out of it.

Chris: Definitely, it really sounds beautiful and makes the songmemorable.

Vito: It's a hell of a thing to do live though...it switches im-mediately from acoustic to electric but I have a separate ampsystem that duplicates the sound of an acoustic so all I have todo is hit a switch.

Chris: The whole record has a really clean sound and a lot ofinteresting changes like that one. It was produced, recordedand mixed by Michael Wagener. How was it working for him?

Vito: Excellent! The guy is really incredible. I mean he is becom-ing a name really fast because of his work with Dokken andeverything he's done.

Chris: Had you ever worked with him before?

Vito: No, this is the first time and this was a really good situa-tion because we didn't go looking for him. He called us up. Hehad heard "Fight To Survive" on the radio, and bought it. So hewas basically a fan of the band. He heard through the industrythat we were about to get signed and he knew we needed aproducer so he called us. So he wanted to work with us whetherwe had a deal or not, 'cause he just liked the band and he lovedthe music and everything. And the guy is great. Someproducers will come in for an hour or so and then leave you withthe engineer and not even really pay attention, but this guy camein every every afternoon at 12:00 and stayed 'till two in the morn-ing. Did not even move, when we went to dinner he would eatwith us and it didn't matter... like I could turn around and say Ithink I need new strings and he would drive me to the musicstore. He didn't have an attitude.

Chris: He really became a friend to you guys.

Vito: Yeah, he was like a fifth guy in the band, I mean he just satthere. He was great. I just couldn't be loud enough for him... hekept getting me amps. He was the original guitarist in Acceptand not too many people know that, he started the band withUdo. Yeah so he has that... in him even though he's married andhas family life he has it in him. I remember it was his weddinganniversary, he was just married a year and I said "What are youdoing in here?" and he said "I'm working with you guys." Hegave up anniversaries and his birthday. He just sat in that studiowith us and would not leave.

Chris: Well, no wonder he's turned out so many great records.

Vito: Oh, he puts himself out, I mean when your producer pullsup in this big Lincoln blasting the first Van Halen record its cool.

Chris: It is. Well how about future recording plans then.

Vito: Oh, there's always something in the works. I think aproblem with a lot of bands is that they spend all their time wait-ing for that record deal, and when the first album comes outthey use all their best songs that they've written over their life

and the second album they have like amonth to write.

Chris: How's your next doing?

Vito: Well, I'm writing now.... I'm abouthalf -way through the next album. Wedid the Frehley tour and that startedabout a week before the record cameout, and now we just ended it a coupleof weeks ago so when I have a fewweeks here and there off I just keep writ-ing.

Chris: Great, can we look for anyvideos?

Vito: Yeah, as a matter of fact we justgot the word today. For "Wait". Thatgets done the last week of August. Andwe'll be using La Company, they're theones who put out the Bon Jovi videos,Van Halen, David Lee Roth and a lot ofthe other big major videos you see onMTV.

Chris: Is it going to be a live perfor-mance or a concept video?

Vito: Well, see they wanted to do "All You Need Is Rock AndRoll" as a video, cause they figured it would lend itself better toperformance video but "Wait" is doing really good.

Chris: Do you know if you guys are gonna have any imput intothe video's theme or whatever?

Vito: See that's the hard thing, it's funny because Atlantic total-ly trusted us with the album and stuff but I don't know how it willbe with the video. I guess they have their video department andit's their job to create them, I really don't know yet if I'm gonnahave any imput into it but I'd like to because I really don't wanta video where you see a shot of some girl for three minutes ofit and the band is shown once in a while. We'll probably all havesome imput but whether they'll use any of it I'm not sure.

Chris: Well, while were waiting for the vid, when can we see youon the road again?

Vito: We start again with Ace Frehley on September 4th, andthat ends up at the Beacon Theater in New York on September12. When we were on tour with Ace any time we had a night offwe would go to the nearest town that knew us and headline, butwe're not well known enough to make an impact.

Chris: Well, you guys are certainly beginning to make an im-pact on our chart, with increasingly more and more stations.There's quite a buzz building around you.

Vito: That's really great to hear. All the ads and publicity fromAtlantic haven't hit yet. A lot of these magazines seem like theyare three months behind. So with a lot of these bands when theiralbums come out you see all these ads and you think "wow"what a major push, it's timing... but we wanted to rush the albumout. We came back May 4th and four weeks later it was doneand ready to ship. So none of the ads have hit -- so you've gotJune, July and August. There's you're three months. So in Sep-tember the articles in "Hit Parader", "Circus", "Cream" and theads, people are gonna see.

Chris: The first time I ever saw or heard of you guys was froman issue of "Hit Parader" in I guess around '84.

Vito: Oh, that little picture in the new bands section. (Laughs)

Chris: Yeah. I'm really glad to see you guys doing so well.

Vito: Thanks, me too.

Interview By Christine Black

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (28)

HARD REPORTTHE MUSIC NOW!

Music Now! is contributed by Mike Cooper. P.O. Box 4111 Atlanta, GA 30302. 404-627-2834.

PETER WOLF says a report in "Billboard" magazine that he hasrejoined the J. Geils Band is wrong. "It's not true," Wolf says.While he says the recent reorganization of his record labeldidn't help his second solo album, "Come As You Are," he doesplan to tour in the fall. "I want to get out there and do some spe-cial, intimate things in the city and around the state (of Mas-sachusetts)."

GEORGE THOROGOOD & THE DESTROYERS will beginrecording a new album after a three-week club tour.

A federal district judge gave a last-minute victory to the BEAS-TIE BOYS, two days before they appeared at the Jacksonville,Florida, Coliseum. U.S. District Judge John Moore issued atemporary injunction against the "adult subject matter' warn-ings that city officials ordered for tickets, advertisem*nts andcommercials for the show. The judge ruled that the city shouldremove the warnings from all advertising and tickets sold in thetwo days after his decision, before the group's show.

Promoters seeking donations for a planned Rock & Roll Hall ofFame in Cleveland say they will extend their planned Labor Daydeadline for raising $2.6 million. Project coordinator Chris-topher Johnson says fund-raisers are being planned to raisemoney for the museum. So far, only $220,000 has been raisedfrom about 8,000 contributors since the fund-raising effortbegan in early June.

THE CURE have completed a video for "Catch," the next singlefrom the album "Kiss Me, Kiss Me, Kiss Me." Lol Tolhurstdescribes the track as "soft and summery."

U2'S tour in support of "The Joshua Tree" will begin September10-11 at the Nassau Coliseum and end December 11 inHamptom, Virginia.

Rhino Records has purchased the rights to PHIL SPECTOR'Scatalog and plans to release a boxed -set of digitally remasteredSpector material in October. The 60 -song compilation will becalled "The Wall Of Sound: The Essential Phil Spector."

LORNA NELSON, half-sister of PRINCE, has sued him claim-ing that he has stolen her song lyrics. "I don't want anything tohappen to Prince. I'm just trying to get my businessstraightened out," Lorna Nelson says. Nelson filed the lawsuitin Minneapolis, claiming that Prince used lines from a song shehas copyrighted called "What's Cooking In This Book" and in-cluded them in his song "U Got The Look." She also says thatPrince took material from two of her other songs for "Love OrMoney and "Around The World In A Day." A spokesman forPrince denies the allegations. Nelson, who says she is an un-employed lyricist attending business school, says she turneddown a proposed $25,000 settlement.

LINDSEY BUCKINGHAM is leaving Fleetwood Mac. Remain-ing members of the band are to announce the names of twopeople to replace him. In an interview a couple of months ago,Buckingham had hinted at leaving the band. "I certainlywouldn't be surprised to see John, Christine and Mick contactan English guitarist or something," he said. "That certainly hasbeen the pattern. There have been a lot of incarnations of Fleet-wood Mac."

DAVID BYRNE of the TALKING HEADS has gotten married toAdele "Bonnie" Lutz. The wedding was revealed in a letter Byrnesent to a friend in Dallas while working on a movie soundtrackin Europe. "While I was there, I went to Paris for a weekend withmy friend Bonnie and got married," the letter says. Lutzdesigned some of the strange outfits that appeared in thefashion show featured in the film "True Stories."

The controversial book, "Spy Catcher," which tops the NewYorkTimes best seller list, will be turned into a film by an Americancompany. Peter Wright wrote the book, which has been bannedin Britain. Elton John has revealed that he's been asked to com-pose the music for the movie.THE FAT BOYS plan to sue Miller Lite and Joe Piscopo over acommercial that features three rappers that look a lot like theband. "They asked us to do a spot, but we turned them down,"says Charles Stettler, the band's manager. "What Miller has

done is a total imitation, so now we're suing for big money."Stettler predicts that the three members of the Fat Boys are"going to get Ferraris for Christmas."

GEORGE HARRISON has been fined $80 after admitting thathe was speeding along a British freeway. Harrison, who livesin Friar Park, Oxfordshire, was sentenced by a west Londoncourt. Police had said that Harrison was travelling between 90and 100 mph when he was stopped. Harrison said he had beendoing 84 mph on the M4 highway. "We will accept the speedthe defendant has pleaded guilty to," judge Michael Nicholassaid.

VAN MORRISON will lead a weekend of discussion and perfor-mances in Britain in September called "The Secret Heart OfMusic." The British gathering is intended to explore the powerof music to change consciousness. Morrison will perform at thethree-day event, along with Robin Williamson, founding mem-ber of the Incredible String Band and Derek Bell of the Chief-tains.

JOHN HIATT says his new album was recorded in four days ona budget of just over $15,000. "I'm from another era, and I'mjust trying to get along here," Hiatt says. "I know nothing aboutall these huge advances in technology other than how to availmyself of them." "Bring The Family is Hiatt's eighth album forhis fourth record label. "All the basic singing and playing -- thefour instruments and my voice -- were all cut at the same timein the same room on the same day by the same four guys," Hiattsays. Ry Cooder, Nick Lowe and Jim Keltner performed on thealbum. "The overbuds were minor. It has the spontaneity andhonest emotion from my live shows that is missing from my pre-vious records."

BOSTON have decided to extend their current tour for anothertwo months. "We're having too much fun to stop," says TOMSCHOLZ. "We didn't think it would be this much fun. In fact, I

was the first one to volunteer to keep it going until Christmas.We'll fill in places we missed -- like Washington, Atlanta, Floridaand some Midwest cities." The band's nine concerts at theCentrum in Worcester, Massachusetts, will be filmed andrecorded, but only for personal purposes. "I've been pretty con-sistent in not wanting to do a live album, because a live presen-tation is an audiovisual presentation in a controlledenvironment," Scholz says. "but as soon as you take away thevisual part and put it on a record and through someone's stereosystem which you have no control over, then you destroy allthe impact of it." The band broke their own box office recordwith the nine -day series of concerts at the Centrum. The pre-vious record at the venue was four sold -out dates. The bandalso recently set a record by playing four nights at Alpine Val-ley, between Chicago and Milwaukee, averaging 27,000 ticketsa night. The band also drew 50,000 fans to two shows at theTacoma Dome in Seattle.

BRUCE SPRINGSTEEN has completed work on his latestalbum. "Tunnel Of Love," Springsteen's ninth album, it will bereleased in the early fall.

GREGG ALLMAN briefly checked into Roosevelt Hospital inNew York complaining of chest pains. "He was having somechest pains and some discomfort trying to breathe," says hismanager, William Perkins. "He's feeling fine now." Allman wenton to play a scheduled date in Portland, Maine.

DEBBIE HARRY will begin work on a new solo album in a NewYork studio in late September.

The 10 -year -old album "Cybill Shepherd Sings Cole Porter" willbe re -issued soon. The LP will be repackaged but should in-clude the 14 tracks that appeared on the original album.

PAUL MCCARTNEY is asking Beatles fans not to buy any ofthe Beatles records being issued in Japan by companies takingadvantage of copyright law. Copyright law in Japan only ex-tends for 20 years from date of release, and so early Beatles al-bums are being released in "low quality" reproductions,McCartney says. He says the band won't get any royalties fromsales of the new discs.

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (29)

THEHARD REPORT MUSIC NOW!

SHIRLIE HOLLIMAN, half of the PEPSI & SHIRLIE duo, hasbeen signed up by RKO Pictures to star in a new movie. Herresemblance to Doris Day has earned her the lead role in a filmbiography of the 63 -year -old actress.

DUSTY SPRINGFIELD teams up with the PET SHOP BOYS ona track called "What Have I Done To Deserve This?" She flewto London to film a video for the song with the band. The PetShop Boys will have a new album out in September.

PUBLIC IMAGE LIMITED are releasing their first album in overa year next month. The first single from the LP in Britain is "Seat-tle.

JIM JARMUSCH has directed the video for Big AudioDynamite's "Sightsee MC." "The track is Jarmusch's favoritefrom the album, so that was the perfect opportunity for us torelease it," says Mick Jones. "We've been pals with Jim sincewe met him in New York when doing 'Upping Street' and he be-came a fan of the band. I really liked his first film, 'Stranger ThanParadise,' and 'Down By Law' rea ly knocked me out."

Former GANG OF FOUR songwriter and guitarist ANDY GILLhas recorded a song for Derek Jarman's new film, "The Last OfEngland." Gill also has a new single out in England called "Dis-possession." Gill has been producing bands in Los Angelessince the Gang Of Four split up, as well as writing new material.

The team of MIKE STOCK, MATT AITKEN and PETE WATER -MAN, who have worked on hits by Mel & Kim, Bananarama andSamantha Fox, will be working on two songs with Judas Priest.One of the tracks will be a tune written by the three, and theother will be an old R&B song. If their work with other acts isany indication, it won't take the production team long to comeup with the material. Waterman claims that "Venus" byBananarama and "Showing Out" by Mel & Kim were bothrecorded in a day. "We started on 'showing Out' at 6 o'clockone evening, and it was on the radio before 11pm the next day.I suppose we spent about 10 hours in the studio," Watermansays. "We write on the run. If nothing materializes in ten minuteswe abandon the idea. And we record in the same way. I can im-agine some of these Americans wanting to spend three or fourdays getting the drum sound to their liking. We don't work likethat."

FRED SCHNEIDER of the B -52'S has a book of poetry & prosecoming out this fall that he calls "something I've always wantedto do. I've always written and I consider myself more of a writerthan a singer or whatever."

REM are tentatively scheduled to begin touring the U.S. Oc-tober 1 in Knoxville, Tennessee. It's expected that 10,000Maniacs will open for the first month of the tour, and the dB'swill open for dates in November. The dB's will begin a collegeand club tour in mid -September before opening for REM.REM's new album, "Document," includes a cover of the Wiresong, "Strange."

CONCRETE BLONDE are working on tracks for the follow-upto their debut album.

ALICE COOPER'S new album is now titled "Raise Your Fist AndYell," and will be out in early October. Cooper will begin tour-ing at the end of October, following a month of European datesin September. Cooper's guitar player, Kane Roberts, will havehis own sdlo, self -titled album out just a few weeks before theCooper LP.

Almanac Monday August24

compiled by:

Mike Cooper

1984 The Churchrelease the album"Remote Luxury."1983 Death of Jerry Lee

Lewis' fifth wife, Shawn, apparently from an overdose ofprescription drugs, at their home in Mississippi.1981 Mark Chapman is sentenced to 20 years to life in prisonby a New York court after being convicted of the murder ofJohn Lennon.

1979 The Cars play to almost half a million people in New York'sCentral Park.1961 Birthday of Chas Smash (Mark Bedford) of Madness, inLondon.1954 Birthday of Geoff Downes.1945 Birthday of Ken Hensley, formerly of Uriah Heep andBlackfoot, in London.1944 Birthday of Jim Capaldi in Evesham, England.1943 Birthday of John Cipollina of Quicksilver Messenger Ser-vice, in Berkeley, California.1938 Birthday of songwriter and guitarist Mason Williams("Classical Gas"), in Abilene, Texas.

Tuesday August 25

1979 Gary Numan's "Cars" single is released.1978 Sham 69, the Tom Robinson Band, John Otway and PattiSmith headline Britain's Reading Festival.1973 Guitarist Henry McCullough leaves Wings.1973 Butch Trucks of the Allman Brothers Band breaks his legin an auto accident in Macon, Georgia.1970 Elton John makes his live debut in the U.S., at theTroubadour Club in Los Angeles.1962 Little Eva's "The Locomotion" is the top single in the U.S.1954 Birthday of Elvis Costello (Declan McManus) in Liverpool.1951 Birthday of Rob Halford of Judas Priest, in Birmingham,England.1949 Birthday of Gene Simmons (Klein) of Kiss, in Queens,New York.1918 Birthday of composer Leonard Bernstein, in Lawrence,Massachusetts.

Wednesday August 26

1985 John Cougar Mellencamp releases the album"Scarecrow," Loverboy release "Lovin' Every Minute Of It."1983 Black Sabbath headline Britain's Reading rock festival,with Bev Bevan of ELO temporarily serving as drummer, andIan Gillen in the band.1980 Bass player Tom Peterson leaves Cheap Trick, to bereplaced by Pete Comita.1980 Fleetwood Mac deny rumors that they are breaking up.1977 Ian Dury's "Sex & Drugs & Rock & Roll" is released.1970 Jimi Hendrix makes his last public appearance, toppingthe bill at the Third Isle of Wight Festival. Also performing at theshow, the Doors, Emerson Lake & Palmer, Richie Havens, theWho and Donovan.1967 Bobby Gentry's "Ode To Billie Joe" is the top single in theU.S.1967 The Jimi Hendrix Experience album "Are You Ex-perienced" enters the U.S. charts.1967 The Beatles, Mick Jagger and Marianne Faithful! attend atranscendental meditation course at a Welsh university taughtby Maharishi Mahesh Yogi.1967 Britain has its first organized hippie festival, the FestivalOf The Flower Children, at Woburn Abbey.

Thursday August 27

1984 Talking Heads release the album "Stop Making Sense,"Blancmange's "Mange Tout" LP is released.1982 Iron Maiden, the Michael Schenker Group and Budgie topthe bill at Britain's Reading Festival.1981 Neil Young's "Rust Never Sleeps" film gets its Britishpremiere.1978 Jon Lord joins Whitesnake.1967 Beatles manager Brian Epstein is found dead at his Lon-don home, apparently after overdosing on sleeping pills.1965 Bob Dylan releases "Highway 61 Revisited."1965 The Beatles meet Elvis Presley for the first and only time,spending the evening at Presley's home in Bel Air, California.1965 Birthday of Glen Matlock, former member of the Sex Pis-tols and the Rich Kids, in London.1953 Birthday of Alex Lifeson of Rush in Fernie, British Colum-bia, Canada.1950 Birthday of Willy DeVille in New York.1949 Birthday of Simon Kirke of Free and Bad Company, inLondon.

Friday August 28

1984 Iron Maiden release "Power Slave."

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (30)

THEHARD REPORT MUSIC NOW!

1983 Thin Lizzy play their farewell concert, at the Reading RockFestival in Britain.1982 Snowy White leaves Thin Lizzy, to be replaced by JohnSykes, formerly of the Tygers of Pan Tang.1982 Blondie cancel a proposed tour of the U.K. because ofpoor ticket sales.1978 Tom Verlaine's band Television breaks up.1969 Paul and Linda McCartney's first daughter, Mary, is born.1965 Sonny & Cher's "I Got You Babe" tops the British singleschart.1963 Bob Dylan and Joan Baez perform to 200,000 civil rightsmarchers gathered at the Lincoln Memorial in Washington, D.C.,where Martin Luther King gives his "I Have A Dream" speech.1949 Birthday of Hugh Cornwell of the Stranglers.

Saturday August 29

1985 Squeeze release the album "Cosi Fan Tutti Fruitti," Star -ship release "Knee Deep In The Hoopla."1981 ELO's "Time" is the top album in Britain.1976 Spirit reunite for a concert in Santa Monica, California,with Neil Young joining them for an encore.1970 Edwin Starr's "War" tops the U.S. singles charts.1967 The Clash make their public debut, supporting the SexPistols in a late -night concert in North London.1966 The Beatles play their final public concert, at SanFrancisco's Candlestick Park.1958 Birthday of Michael Jackson in Gary, Indiana.1958 George Harrison joins the Quarrymen, the skiffle groupstarted by John Lennon.1945 Birthday of Chris Copping of Procol Harum, in Essex,England.

Sunday August 30

1984 Dave Edmunds "Riff -gaff" album is released.1984 An auction of Beatles -related memorabilia by Sotheby'sof London raises almost $300,000.1979 Dave Pegg joins Jethro Tull as bass player.1978 The Joe Jackson Band makes its live debut, in London.1973 Drummer Denny Seiwell leaves Wings, just as the bandis about to go to Nigeria for recording sessions.1973 The Doors, after making two albums as a trio followingthe death of Jim Morrison, break up.1972 John Lennon & Yoko Ono play two shows at MadisonSquare Garden for the "One To One" charity for handicappedchildren.1969 Zager & Evans top the British singles chart with "In TheYear 2525."1969 The Texas International Pop Festival begins near Dallas,with 120,000 people paying to see Led Zeppelin, Canned Heat,Janis Joplin, Santana, Chicago, Sly & The Family Stone, B.B.King, and others.1968 The Beatles' "Hey Jude" and Mary Hopkins' "Those WereThe Days" are the first singles released on the Beatles' AppleRecords label in Britain.1953 Birthday of Horace Panter of General Public.1950 Birthday of Mick Moody of Whitesnake.1941 Birthday of John McNalley, guitarist with the Searchers,in London.

Here's the latest music news Live From Londoncourtesy of CFNY, Toronto and our exclusive reporterLee Carter. Lee can be heard on CFNY's "SundayMusic Magazine" program and on "Live FromLondon" aired Wednesday evenings.

Undoubtedly the biggest piece of music news in Britain thisweek is the arrival of MADONNA, who at time of writing was justabout to play three nights at Wembley Stadium. Young fanscreated chaos at London's Heathrow Airport as the star arrived.The British media have gone dutifully nuts over this country'sbiggest seller of records, leaving staggering statistics in herwake. Love her or hate her, to the rest of the world Madonnarepresents American glamour par excellence, conjuring up lostdays of the golden girls of Hollywood like, although she herselfloathes the comparison, Marilyn Monroe. It is also the first timeshe has played Britain since the beginning of her career, soBritish fans who have lapped up videos of her American toursnow want a slice of the pie. Few will remember that, as an aspir-ing pop star, she did enjoy her early success in Britain beforestriking it in her native America, playing small clubs like

Manchester's Hacienda and gaining a TV appearance on "TheTube". A few weeks later "Lucky Star" was released and shot tonumber two in the U.K. charts, some six months before her suc-cess in the States. All this may not particularly endear her toEngland, though. The last time she was here was to shoot partof her (flop) movie "Shanghai Surprise". The reprehensibletabloid press hounded her and husband Sean Penn all over thecountry, culminating in Penn knocking down a particularly per-sistent reporter in his car. Hundreds of thousands of Madonnafans sold out the three shows within 24 hours, while there wasa nailbiting wait for news as to whether the concerts would goahead at all. Local residents, citing too many shows and dis-respectful behaviour from concert -goers attempted to get themstopped. The concerts at Wembley, sited in the middle of aresidential district, will be seen as a test of good behaviour fromfans attending Madonna's concerts.

The BEATLES are continuing their spate of legal actions torecover what they see as money made in their name by exploi-tive practices. Following their suits against Capitol Records inAmerica and Nike shoes, they have now issued a writ in Lon-don against Dave Clark - he of The Dave Clark Five fame. YokoOno and the three surviving Beatles claim that Clark and EMIRecords, who distribute their music, are selling video compila-tions that include Beatles music, without the group's permis-sion. Five years ago, Clark bought out the rights to all thefootage from the legendary sixties pop TV show "Ready SteadyGo". He created compilation videos of the series, some of whichhas also been broadcast on British television. The Beatles claimthey have not received royalties for their performances and werenever consulted about their distribution. A spokesman for EMIdeclined to comment on the details of the case but said thatthey would, "in conjunction with Dave Clark, be defending thecase very strongly."

PETER GABRIEL and STING are two of the acts who have an-nounced their participation in a worldwide Amnesty Internation-al benefit tour. Other top acts are expected to join the 60 -datejourney through Europe, Asia, Africa and Latin America to raiseawareness of the pressure group's work to release prisoners ofconscience. The tour is being arranged by Jack Healey, Execu-tive Director of Amnesty's U.S. Section who says that full detailswill be announced in the New Year, with the actual tour kickingoff later in 1988.

The British media are reacting in a manner that I suspect issimilar to their American counterparts, to commemorate thetenth anniversary of the death of ELVIS PRESLEY. The nation-al rock and pop network BBC Radio One is dedicating all ofSaturday and Mondayto Elvis music and the television networksare reacting with similar enthusiasm. "The New Musical Ex-press" decided to find out how some of the U.K.'s rock per-sonalities feel about the death of Elvis. Here are some of theirresponses: "I was having a piss when I heard Elvis was dead.I came back home and went to the toilet and the radio was on.They were playing 'I Just Can't Help Loving You' and the deejaysaid that Elvis had just died. I was so drunk that when I wokeup the next day, I'd forgotten about it and didn't realise 'til I sawthe papers. So I found out twice. What does Elvis mean to me?'Mystery Train'" - Billy Bragg. "Elvis was dead before he diedand his gut was so big it cast a shadow over rock and roll. Ourmusic is what's important now" - Johnny Rotten. "I believe thatElvis Presley was a genius. He didn't express himself the waythe middle classes do, which is with wordplay. He acted on in-stinct and expressed himself by the way he held themicrophone. I believe the essence of any performer is gut in-stinct" - Bono. "I remember the moment exactly, hearing it onthe radio. I was eating a cheese roll in the kitchen of my parents'pub. It was the day after my sixteenth birthday. It didn't affectme like the death of Lennon, but the period from going into thearmy until his death is symbolic of the way youth rebellion issterilised, hom*ogenised and commercialised by the powers thatbe. But he still had a fab voice" - Matt Johnson, The The. "I wasseeing if he could cram in one more burger. Elvis meant littleor nothing to me. I was one of those kids who used to go to themovies to see Cliff (Richard) and we'd boo at Elvis because hewas American and Cliff was homegrown. Mind you, I thoughtDylan ripped off Donovan" - Andy Partridge, XTC. "I was at agig at The Vortex in London and somebody jumped onstageand made some typically punky statement about how Elvis haddied and it was a good thing. Obviously I was totally outragedbecause Elvis and Little Richard had literally changed my lifewhen they came along, although in my ludicrously purist way Idon't think he ever made any good records after he came out

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (31)

HARD REPORT MUSIC NEWSof the army" - John Peel, legendary alternative deejay. "Has agreater voice ever been heard? His appeal was so vast andvaried, more than any other known recording artist. Here wasa singer who would appeal to all policemen of all sexual com-plexions" - Morrissey, The Smiths. "What did he mean to me?He had more hair than Bill Haley. like to know the name ofhis doctor - Wayne Hussey, The Mission.

New Order's BERNARD SUMMER is rumoured to be startinga solo career with a major label. A spokesman for Summer saysthat he has some material ready, that it's very different from NewOrder's usual sound and that they will be looking for interestedparties in his work when the band go over to the U.S. soon. Itis stressed that their is no rift in the group and that New Orderwill be continuing as normal. This week the group release "Sub-stance", a collection of all their 12" mixes to date on one album,including their latest single "True Faith". In addition, there arenew versions of "Temptation" and 'Confusion". These are theversions that appeared in the movie soundtracks "SomethingWild" and "Salvation". "Substance" s also available on a doublecassette and CD.

DEPECHE MODE release a new single "Never Let Me Down"on 24th August (no relation to the Bowie song). The band whoare currently on holiday before starting rehearsals for theirEuropean tour, have just completed work on their sixth album,produced by the band with Daniel Millar and Dave Bascombe.

BIG AUDIO DYNAMITE were in a boisterous mood at thelaunch party for MTV Europe in Amsterdam. They arrived therewith about 30 Hells Angels (normally not quite as fierce as theirAmerican counterparts) who mingled uneasily with record com-pany types and assorted liggers. When BAD took to the stage,the yuppie musos virtually ignored them, continuing to chataway about the latest ranges of burglar alarms and Vidal Sas-soon products. So indignant were the band they left the stage,accompanied by their biker pals and went up to the fifth floorbalcony and buffet. From this advantageous height they wereable to throw pate, coleslaw and pies at the astonished musicbiz. Is this a new definition of shifting units?

MICK JAGGER is going to extraordinary lengths to ensure thesuccess of his second solo album, "Primitive Cool". In a moneyno object bid to make it the biggest rock news of the year, hehas spent a fortune making a video for the title track. Sourcesat The West Side Studio in New York, where Jagger is puttingthe finishing touches on the project, say he is determined toprove that he is not over the hill. The video is being directed byaward -winning Polish film maker Zbigniew Rybzynski - famousfor his off -film antics too. In 1983, he was gaoled for attackingtwo policemen. Rybzynski has hired hordes of Guardian An-gels, pizza waiters, belly -dancers and body builders to appearin the video and the album sleeve promises to be a controver-sial cracker too! Jagger has commissioned Italian artist Fran-cesco Clemente to paint his portrait Clemente is noted for hissurreal work, which centres on sex, religion, fear and death.

"Snub TV" is a new half-hour show produced in London, whichis to be broadcast on "USA Network", the cable TV station in theUnited States. "Snub TV" will showcase Indie groups andpromises interesting and bizarre music features. The first showfeatures The Fall, Bambi Slam, The Pastels, an interview withJohn Peel, The Mekons and Pop Will Eat Itself. The show goesout every two weeks on Saturday night and is repeated the fol-lowing week. "It's a deliberate contrast to the 24 -hour blandrotation of rock TV in America," Peter Fowler told "Sounds"magazine. He claims that "USA Network" has more subscribersthan MTV in North America.

STEVE JONES, the ex -Pistol, has released his first solo album,"Mercy', with the title track being released as a single this week.It also features "Pleasure And Pain", Jones' contribution to the"Sid and Nancy" movie. After several years of unsuccessfulprojects, Jones recently teamed up with Andy Taylor to writeand record some material for the film "American Anthem". Healso went on to co -produce Taylor's forthcoming album"Thunder" and also worked on Iggy Pop's "Blah Blah Blah".

U.K. Industry News:In a special report on the state of heavy metal in the U.K. theequivalent of "Billboard" here, "Music Week", sees the dawningof a new era for British metal and AOR. Despite the abundanceof talent here of metal acts, there has been difficulty in promot-ing the groups on home turf and it is a market that has been

traditionally seen as a vehicle of export to the U.S. only. Themost celebrated case was Def Leppard, who while sportingunion jack T-shirts onstage in America in 1984 where they be-came massively successful, they were virtually unknown here.But all that is changing according to "Music Week". Recordcompanies are realising that metal, if promoted properly, will fillthe gap left in the natural ten-year cycle since punk and alreadythe charts and radio playlists are reflecting for the first time alarge popularity for groups like Whitesnake, Def Leppard, BonJovi, etc.

IN BRIEF:NEIL TENNANT from The Pet Shop Boys has come in for a bitof shtick from his old school, St. Cuthberts in Newcastle in north-east England. The catholic school has taken offence over theirnumber one hit "It's A Sin" where Neil croons sarcastically, "Atschool they taught me to be so pure in thought and word anddeed. It's a sin." "It's unfortunate that Neil has painted this pic-ture of his school days and the things he was taught," sniffs oneof his old teachers. "It's a long time since he was here, but wereally were quite forward thinking.".... One of the rumours aboutJOHNNY MARR's future (having just left The Smiths) is thathe's off to live in America for good. The remaining Smiths,meanwhile, have said they hope to announce a new memberwithin two weeks. Smiths fans have been expressing their out-rage at The Smiths continuing to use the band name in the col-lumns of the music papers' letters pages.... WAYNE HUSSEYof The Mission and BONO are said to be great pals. Theychatted for over an hour at U2's Edinburgh concert and a dickiebird tells me that Bono has offered Wayne the use of his cottagein Cork on the south coast of Ireland for his vacations.... MIL -LIE SMALL who was just 15 years old when she recorded "MyBoy Lollipop" for Ireland Records in 1963 came very close to aSupremes-like tragedy in her hard life. She recently appealedto Island boss Chris Blackwell for help and he set her up in anapartment in South London. Previously, times had got so roughfor Millie that she lost her home in London and ended up sleep-ing in cardboard boxes and washing in public toilets. Since there-release of "My Boy..." she has begun earning around $400 amonth from royalties.... DEF LEPPARD are predicting that"Hysteria" will sell 14 million copies. Joe Elliot also boasts, "If we

Bon Jovi would have never existed. Whatthey're doing we were doing three years ago."

NEW RELEASES:The major album of the week is New Order's "SUBSTANCE". Ifyour station is a supporter of the band, you should have all the12" mixes already. Still, it is a shrewd marketing tool to interestnew fans of the group in the way that "Louder Than Bombs" didfor The Smiths. For their 12" records New Order are second tonone, providing blistering radical dance music for five years....Speaking of The Smiths, radio programmers may find their newsingle "Girlfriend In A Coma" a bit of a disappointment. It is verylaid back and at 2.02 very short, although it will gain somenotoriety for the addition to the growing list of unspeakable sub-jects that Morrissey is all too willing to speak about, in this casehis dying girlfriend. Track two on the B-side of the 12" "I KeepMine Hidden" is, however, fab - particularly Morrissey's whis-tling!... The HOUSEMARTINS' latest, "Me And The Farmer" iswonderful. Fast -paced up -tempo fun in the tradition of "Sheep"and "We're Not Deep". There's plenty of mileage left in some ofthe best purveyors of high quality pop. Best record from the al-ternative indie world, "Give Us Our Flag Back" by Ruby Blue(Red Flame) the duo of the staggeringly beautiful RebbeccaPidgeon and Roger Fife, both multi -instrumentalists Soundslike the original call to arms by Jefferson Airplane but bathed inglorious and compelling '80s production.

Finally, over at a friend's house recently I plucked from his book-shelf and began reading "The Outsider", a 1928 novel by theFrench writer Albert Camus. It's the story of an angst -riddenyoung Algerian man who feels curiously unemotional about hislife and the morality of society. The climax in the book is a mo-ment of descriptive terror as he squeezes the trigger of a gunand shoots a man on a beach. The dead man is only identifiedin the book as an Arab, I suppose partially because of the book'sold-fashioned writing and to identify one of the many ethnicgroups that made up the French colony. The rest of the bookdescribes his trial in court. Now you know where The Cure got"Killing An Arab" from. In light of this admittedly obscurereference, are the actions of American radio stations and theirrecord company right or wrong? One to ponder on until nextweek. Cheerio.

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (32)

HARD REPORT RADIO COMMENTSBob Welch, WQBK, AlbanyThe Cars? Crossover smasheroo. Response has been 100%positive.... Also new: T -Birds' "How Do You Spell Love. Looser,slower than their last one and it shows their roots as a bar band.Classic T -Birds.... Finally in on the Paul Kelly, now that we'resure it's gonna' last more than two weeks.... Aerosmith withhorns? Yes!... David Bowie's "Never goes to heavy. It was ouroriginal pick when the album came out, and we've been play-ing it all along. This is the tune.... Considering: Everything onthe new John Cougar album.

The Bearman, WGTR, MiamiA) Who the hell is Melvin James and B) Why haven't we heardfrom him until now?... We put that Aerosmith on and it's clichetime for them. The phones blew out, #2 calls after the first week.How much more automatic does it get? And I've heard the restof the album and it's not necessarily the strongest song.They've got a keeper this time around....

Carolyn Wessel, WBYR, BuffaloWe got an early release on the Aerosmith album here, and we'vehad fabulous reaction to the whole thing. "Hearts On Time"seems to be the early leader, but the overall interest level is ex-tremely high across the board.... I think the Cars sound morelike a solo Ric Ocasek. I wish it had more balls, but the curiositycalls are there.... Also new: Glen Burtnick. They've been buggin'us for a while to play it and finally wore us down the tenth timearound. But it is a song that really grows on you.... WE also wentwith Omar's "Canebreak". We were playing three tracks fromthe album earlier and our listeners have already seen him herelive in Buffalo with tremendous response. So our listeners knowOmar and, thus, we want to be early on all the songs.... Moves:to heavy: Cruzados' "Bed Of Lies". People are getting realfamiliar with it now, and we're getting more response than wethought we would.... Grateful Dead's "Hell In A Bucket". We'restill four tracks deep and that's the one getting the most calls....Sammy Hagar's "Boys' Night Our. "Give To Live" went out lastweek and we needed a heavy cut from the album.... And RogerWaters' "Sunset Strip". He's in town this Thursday and we'll beonstage with Jim Ladd.... And I just want to put in a word for myfavorite song we're playing, Paul Kelly And The Messengers.

Joe Skare, KFMQ, LincolnThanks to A&M's Dick Merkel. I had a chance to see SuzanneVega last night. It was a tremendous show. Suzanne is one ofthe most poetic writers on the music scene today. She has anuncanny ability to paint a vivid picture and evoke emotion withher songs. I was also surprised by her charm and wit in front ofa live audience.... "Hey, Dude!! Play some Aerosmith". That'sthe phrase most popular on our phones this week. "Dude" is akiller track from Stephen and the boys. Big early phones andshould be Top 5 requested soon.... The Cars score a heavy addwith "Tonight She Comes Part 2", "You Are The Girl". It stillsounds good.... Great White is still #1 on the phones for thefifth week running. Def Leppard's "Women" slips a bit butremains Top 5, and Jon Butcher and Grateful Dead's "West L.A."grab Top 5 honors.... Melvin James sounds great on the air andmoves to medium after one week. It's my favorite track rightnow.... And I still like the Brandos' "Gettysburg" a lot. Hope tofind some room for this one soon. Ciao!!

Redbeard, KTXQ, DallasAerosmith promised us that they were gonna' really try to con-sciously write some hits and I think they've certainly got onethere. It's a horny band with horns.... Also new: The Cars. Therewas a lot of anticipation, but I'm still waiting for feedback. Inter-esting, the calls were 60-70% female.... New music I'm excitedabout: we did the world premiere of the John Cougar Mellen -camp, playing it all weekend. I love "Down And Out In Paradise",one of his better piss and vinegar songs, kind of an open letterto the president. The song that's gonna' be a big hit follow-upto "Paper In Fire" is "Hot Dogs and Hamburgers". A greatmedium tempo tune with fiddle for flavor. And "Rudy Toot Toot",

just a fun little rock and roll ditty... Jon Astley is going all theway, with Top 5 calls here.... Great White has really good, bor-dering on heavy sales and phones.... Whitesnake's "You'reGonna Break My Heart Again". Go out and buy the 12" becauseGeffen is going to try to hold this song back. Get it at retail, onthe B-side of the commercial 12". Big popular song here.... And,Oh, Loverboy!! The fact that one of the five songwriters who satbeside me in German class in high school in Zanesville, Ohio,has nothing to do with the fact that we've got it in heavy. It's justa great song; the best thing they've done since "Working ForThe Weekend".... Couldn't wait for the Brandos to come out, soI started playing from the cassingle six weeks ago.... Burtnickshould go all the way.... My personal crusade would have to beThe Cure. You don't have to be research oriented to understandTop 5 retail sales since the first week of release in Dallas/Ft.Worth. Check your retail sales anywhere in the country on TheCure. They did 8000 people here in the biggest hall in town.

Dr. Metal, WHJY, ProvidenceDio - lots of phones for this album. I think Craig Goldie gives thealbum a fresh new sound. A basic Dio record, straight ahead."Dream Evil" and "Night People" and "Make It In The Rain"....Loudness: I'm getting better response from "Rock And RollGypsy".... I just saw Motley and Whitesnake. Thanks for invad-ing Providence. They took the town by storm with several en-cores.... We just did EZO and Autograph last night.... Our nextbig show is September 10th: Ace Frehley and Y&T.

Jeff Ivan, KFMX, LubbockBig thanks to Dave Meneketti of Y&T for a great interview lastweeek. Thanks to Mark from Geffen for setting it all up. "Tempta-tion" is a great second single and will really cross over well. Theinstrumental "I'll Cry For You" just makes you stop and pause.It's a nice number to throw in when you can.... Let me tell youabout a little 'ol rock and metal band from Connecticut calledLeige Lord. Do yourself a favor and take about ten minutes orso, sit down and put on two tracks off their new album...roll "CastOut" and "Legend". Then ask yourself: "Why am I not playingthese guys?" Seriously, these guys are going to be big anddeserve a shot on your station.... Hey about that new Helixsingle: gets your booty a movin'.... The new Celtic Frost isdefinitely different. I'm still not sure it's Mexican Radio.... Wasp:"The Ghoulies" and "Scream Until You Like It" just all make sicksense somehow.... Congrats to EXE who are kicking somemajor butt on the other side of the Atlantic. Have they kickedyour butt yet?... Anthrax's "I'm The Man" is by far the top phonegetter.... And, finally, some strong sales this week from Dio, DefLeppard, Y&T, Whitesnake and Ace Frehley. The "Rock Sol-diers" video is definitely working.

Tom Starr, WOUR, UticaA concentration of major releases like the clutch bunch is superfor the format. Being able to add The Cars, Mellencamp, Rush,Jagger, Yes and younger staples like REM and INXS to the rota-tion arsenal within a two-week period is a real bonanza. Thedown side is the number of developing artists that will get jet-tisoned from rotation or consideration in the process. When youare hosting a party you've got to include those familiar faceseverybody's friendly with and eager to see, but the best hostsand the best parties include the right new faces, too. And what'smusic radio if it's not a party? Recent arrivals at 'OUR party wethink will blend well include Robert Vaughn, Melvin James, TheBrandos (Nothing To Fear") and The Silencers.... Seen thisRolling Stone Top 100 list? Geez, some of the records are asglaring by their inclusion as others are by their omission. It goesa long way towards explaining why I've disagreed with themajority of their reviews over the last twenty years.... Thanks toJay Miggins of CBS for rolling out the red carpet for WOUR con-test winners at the recent Roger Waters show in New Haven.They raved as much about the before and after as they did aboutthe show itself, which they proclaimed as one of their greatestconcert experiences ever.

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (33)

THEHARD REPORT RADIO COMMENTS

David Anderson, WIOQ, PhiladelphiaAll roads lead to Squeeze. Squeeze has returned in a big way.Difford and Tilbrook have come up with another of theirpatented melodies and spiced it up with a touch of horns andthe result is magical. "Hourglass" goes in out of the box.... Arecord that's really grown on me is The Silencers' "PaintedMoon". What a good melodic song.... I have a suggestion: CBS'morning program should adopt this as theirtheme song..."Com-ing To The Rescue".... There were two historic firsts this week.One: The stock market topped the twenty-seven hundred mark.Two: Pete Bardens moved into heavy -- we're bullish on Bar -dens.... Thanks to Bobby Silver of PolyGram for the dinner andthe Level 42 concert. I enjoyed both of them immensely.... Andthanks to Roger Lifeset and Peter Napoliello of Geffen for theconcert and backstage visit with Pat Metheny. Metheny, Mazeand Company were unbelievable! Take it from a somewhat con-cert -weary music director, you've got to see this band live.

Stacey Yelton, WKQQ, LexingtonAerosmith has come up with what has to be the most originalrock and roll I've heard all year. I love to sit down and not haveto say, "Gee, this sounds like so and so".... Hege V could beanybody, but we know he is the son of George Hamilton IV. Butthat still isn't the reason we're playing the record. It's that killerharmonica and biting vocals. Whew! Let me out of that house.

Jim Hurcomb, CHEZ, OttawaThe new Def Leppard album is a masterpiece...amazing varietyand great production. The Guns N' Roses is really impressive.

Paul Marszalek, WMAD, MadisonI get a weekend off, so where do I go? Not Aruba, not Fargo,but back to Chicago for a water-logged weekend. Thank good-ness for my canoe -handling abilities. It wasn't a total loss thanksto Agent J and the great Bonnie Raitt show at Park West. RoyOrbison bumped into Bryan Ferry and we got co*ck Robin.Other cool adds include Joe Ely and the dB's.... Long live Hol-sapple.

Steve McNee, WZXL, Atlantic CityWZXL Wildwood/Atlantic City is looking for Part-timers. ContactSteve McNee 609-522-1416 after 2pm.

Michael Davis, KFMG, AlbuquerqueNow that I'm somewhat recovered from my severe bout of ac-ting P.D., some thanks are in order. To the former P.D., TomMarshall: thanks for your help and patience and your great after-noon numbers. To Lenny Bloch, P.D. at WRCN: thanks for theadvice and words of encouragement. Thanks to the folks at JeffPollack Communications and the staff here at New Mexico'srock leader.

Jeffrey Naumann, Virgin Records, 213-278-1181Two more veritable suchaah Virgin releases you now have arejust screaming to be added. First is real fresh sounding musicfrom Canada's The Northern Pikes. "Things I Do For Money" hasboth intelligent lyrics and an ear -catching melody, which evenprogrammers who have trouble hearing train wrecks will hear.By the way, The Northern Pikes are already blasting up theCanadian charts. One listen and you'll know "Things I Do ForMoney" is an absolute smash. The second new release is the12 -inch "Bang Your Head" (no, not the Quiet Riot song -- noteven close). From Sweden is Lolita Pop. This is Lolita Pop's fifthalbum; the first in English and obviously their first release inAmerica. To set the record straight, there's no Lolita in the bandand they're not necessarily pop either. The sound is somewhatlike Lone Justice without the country feel.... I tip my hat to themany AOR programmers adding the new Cutting Crew track"I've Been In Love Before" so early. Wait no longer. We all know"Been In Love Before" is gonna be a big hit so make it an albumradio hit first.... Finally, put your personal taste aside for asecond and give Warren Zevon's "Detox Mansion" a shot. It real-

ly works. Warren is currently recording "Leave My MonkeyAlone" in Spanish. I can't wait to hear that one.... Congratula-tions to David Grossjesus for landing the KZEW P.D. gig. Goodluck David.... Personal: thanks, Charlie, for the shot.

Eddie Trunk, Megaforce Records, 201-254-6533Many thanks this week to Boobie Bondage, Wild Bill andEVERYONE at Z -Rock. They hosted a wonderful two-hour inter-view with Frehley's Comet. The entire band truly enjoyed it andthe response was great! Let's hope the Z -Rock phenomenoncontinues to grow!!! "Rock Soldiers" from Frehley's Comet con-tinues to be the favorite of the live set and the video is reallystarting to break at MTV. It would be a real shame if an artist asinfluential as Ace Frehley, with a song as positive as "Rock Sol-diers", doesn't get airplay. It's a great rock anthem that tells theyouth of today not to do drugs or drink and drive.... Anthrax hastaken England by storm. First a Top 30 single on the pop chartsand now a devastating appearance at the Donnington MonstersOf Rock Festival.... The debut release from M.O.D. is due outnext week on Megaforce/Caroline Records. "U.S.A. For M.O.D."will be the hardcore underground album of the year. The buzzis tremendous.... Look for the premier of Testament and theirdebut video "Over The Wall" on MTV's Headbangers Ball thisweek.... Thanks again to Z -Rock, a truly great radio station.

Larry Snider, KXRX, SeattleIt's not often we get a second chance. You have a secondchance now, to listen to and add The Razor Backs. No they'renot from Arkansas...they're from the Pacific Northwest...andpossess influences as wide as Chuck Berry, Muddy Waters,Rolling Stones and Robert Cray. It's rock and roll and blues rockat its best. Watch for the re-release on Grudge Records comingto your desk soon. It sure as hell worked for the X. Just put it in,bring it on slow and watch for the results.

Rick Panneck, WAPL, AppletonAerosmith finally puts out an Lp that brings them into the '80s.They have good stuff!... While our CHR competitors poundWhitesnake and the Hooters, we're going on second tracksfrom both bands. Whitesnake has been Top 5 retail since thealbum's release.... Great White continues to blow out the doorsat retail and on the request lines.... The Replacements have ex-ploded at WAPL. If this record works in Appleton, Wisconsin,it'll work anywhere!... And, finally, the Brandos' "Gettysburg"finds its way on our playlist. I was getting tired of Garrett Hartwalking around the station in full civil war clothing.

Doug Clifton, KBCO, BoulderOn the new music front this week: The Cars drive back ontoour playlist with another pop ditty, "You Are The Girl".... PaulKelly finally makes it onto the 'BCO playlist this week, Mark Jor-dan has forced his way on the air, same story goes forSqueeze's "Hourglass", which got rave reviews in this week'smusic meeting.... For that adult appeal we'll try the new releasefrom Richie Havens, Michael Tomlinson, T. Lavitz and ScottCossau.... Thanks to everyone at EMI, especially Suzi Caplanand Norm Osbourne, for showing us a great time at the Bowieconcert. The show was one of the best I've seen this year....Thanks to Sean Coakley and Jay Ziskrout for dragging me tothe Dead show at Red Rocks. I haven't seen that much tie-dyesince 1980, the last time I saw the Dead.... Good to meet DaveRoss from Colorado's wind -powered wonder.... Also, hello toLiz Grove from Chrysalis who stopped by with Gina Horton.Also making visits to Boulder this week, Sharon White and BobMargolis (wait 'til you hear the Robbie Robertson).... Con-gratulations to Nancy Levin who takes the new position asReprise local rep in Denver.... California grabs another ofColorado's finest promotion men as Michael Linehan joins thenational staff of Reprise. Thanks, Michael, for all you've doneover the past few years.

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (34)

THERD REPORT RADIO COMMENTS

Jason Tyler, WRUF, GainesvilleThe "Dude" sounds like a smoker. The original Aerosmith isback in fine form. This tune took me back about 12 years toAerosmith's heyday.... Another emotionally charged tune, "WaitFor An Answer hits the list from Heart. Great music....Whitesnake's "Is This Love" is the same as McDonald's sellinganother billion burgers. You know its going to happen.

Harry Reynolds, KOZZ, RenoI can't believe more people haven't gone Bear hunting. They'vebeen rampaging through our audience since the seasonopened.... The new Cars seemed to be stuck in neutral on thefirst listen, but it has since popped into gear for some heavyrotation.... Tom Kimmel's "Trying To Dance" is a success, and Ivow to find a place for it next week even if we add Rush, REMand the whole Mellencamp Lp.

Phil Manicki, KFMH, DavenportI just got back from vacation and I'm ready to dig in! I want tomention that we've had great response on our two-hour heavymetal show - Monday thru Saturday 10PM 'til Midnight. The onlymetal alternative in our listening area.

Brian Wolfe, WGLU, JohnstownAerosmith's "Dude (Looks Like A Lady)" has all the elements ofa smash. They haven't sounded this good in years.... The Carsseem to be stuck in neutral, but you've gotta play this one.... Myfavorite Fleetwood Mac tune, "Little Lies", goes in this week....Already there are curiosity phones on the Brandos and the In-siders. By the way, the Insiders go heavy!... For a good laugh,listen to the "ever -serious" "Elvis Is Everywhere" by Mojo Nixon.Break out your velvet painting, light a candle, jelly donuts forme!

Donna Geisinqer, Passport/Paras Records, 818-500-7677See Mood Six jump! See Mood Six debut!! Mood Six has"...seen the Light"!! Jumping from 47* to 42* on the "HardReport", 68* to 50* College, 80* to 61* Combined on "CMJ",debuting at 35* on "Gavin" and premiering on MTV's "120Minutes" on August 16th, Mood Six is "lighting" up the charts!!In addition, Mood Six appears at 29 in the first set of "Alterna-tive Club" charts in "FMQB"! If you haven't been "enlightened"with the Mood Six record, call Vic or Donna at Passport/Parasand join those already enjoying the sunshine of this pop Britishband. Don't forget to bring your swimsuit!!

Jay B. Ziskrout, Arista Records, 213-655-9222Thanks to everyone who made time for me as I toured the South-west and West. I had fun and I will be back! (No, that's not athreat).... Hey, how 'bout those S.F. Giants.... Everyone at "TheGavin Report" did a wonderful job staging their first (annual, I

hope) industry baseball soiree at Candlestick Park.... The Grate-ful Dead continue to monopolize album radio and in-store traf-fic as the single of "Touch Of Grey" does its thing on the Top 40side. Meanwhile, "Hell In A Bucket" is building serious momen-tum at rock radio. Make sure you're playing it in heavy as it fliesinto the Top 5. Now I can say for certain...Red Rocks is definite-ly the place to see the Dead.... The Cruzados aren't just "lying"around. Their tour is underway with headline shows, as well asdates with Billy Idol and Joe Walsh respectively. John C. Mel -!encamp has asked the band to play at Farm Aid on September19 in Lincoln, Nebraska... they'll be there. And news of a supportposition on a major U.S. tour will be released soon. The buzzon the street is, "A Cruzados show cannot be missed...theresimply isn't anything better to do 'After Dark'." As "Bed Of Lies"continues to be a strong performer across the country, we aresetting our sights on continuing the Cruzados story with "SmallTown Love" (Don Henley sings backup). We will be releasing asingle to Top 40 two weeks after our 12" (12" on your desk by

Two One-Listen'ersNorthern Pikes Things I Do For Money 12"

This Canadian quartet is currently enjoying a bulleted Top 30single and a bulleted Top 40 album in Canada. From theirforthcoming Lp in America, "Big Blue Sky".No sense fishing around for great new music, hook the North-ern Pikes this week!

Lolita Pop Bang Your Head 12"(It's not a heavy metal record)

This is their fifth album, but the debut in America. Hottest thingto come out of Sweden since the Volvo.

That's Karin Wistrand on vocals!

Virgin TidbitsWarren Zevon has just finished recording"Leave My Monkey Alone" in Spanish

Keith Richards and Stevie Winwood are in their respectivestudios recording their next albums for Virgin.

KFMU's Kathy Blackwood has yet another birthday!What do Michael Plen and Popeye The Sailor-Jesus have incommon? They both have large right arms.

INFOc 1987 Virgin Records America, Inc.

!INFO!

-**04.11M0.N A U ANN

Microscopic NutsSimilar to Munchkin Balls. A

programmer who likes a record

but hasn't got the nuts to add it

(i.e., Even though Jimmy Christopher

likes WarrenZevon's "Detox Man-

sion'. and it fits his station's sound,

he hasn't added it yet because he

llihas Microscopic Nuts)

S m

a T 1 BLPeteWylie

"SINFUL"Your excuses are weak.How 'bout adding it next week?

SUCKAAHH!!!

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (35)

THERD REPORT RADIO COMMENTS

August 26). A big and heartfelt thank you to all who are playingan active role in the breaking of Cruzados.... Hip Hip Hurrah!Hurrah! is a four -piece guitar -based group from NorthernEngland. "Tell God I'm Here" is a rchly produced "Just ToughEnough" pop album that will soon be a favorite here. The pressthat this record and the band's live performances havegenerated has been ecstatic, especially the reviews of theirdates with U2. Those of you who have heard tracks like "SweetSanity, "If Love Could Kill" and "How Many Rivers" know what Iam talking about. Now, let's fill in your listeners.

Matt Pollack, Relativity Records, 718-995-9200Another powerhouse week for the poys down in "Gettysburg".Believe it or not, there's still a few lonesome souls who have yetto hear this band, stuck out in the Rockys or Everglades, unableto see or hear the buzz roaring about on this group. Well, we'vegot news for you. Good word travels fast and far. So no matterwhere you're hiding, we're going to get ya! With one of the mostcaptivating debuts this summer, the Brandos have landed them-selves a comfortable home on 60 stations across the nation.With a song like "Gettysburg", filled with a hook that hits you leftand right, it's only fitting that the Brandos deliver more punchesfrom the same school. And the Lp, which is on your desk andheaded for the stylus, is destined to ;provide at least half a dozenother contenders.

Howard Glassman, WEOX, ManchesterSo I do a whole bit on the Brandos and the record thankseveryone else.... Fine, I'll turn my attention to the dB's. Catchy,witty jangly rock and roll. You can pump the living piss out ofREM, but give the dB's the same recognition 'cause theydeserve it. They've been doing it just as long and just as well.My favorite cut is "Working For Somebody Else".... 10,000Maniacs keep lighting up the phones here. Folks have becomemesmerized by these guys.... One final babble: Putting the SexPistols at number two on their all- time album list was the mostintelligent move Rolling Stone magazine has made in the lastfive years. Just when you thought rigor mortis had set in....

Larry Dunn, WLIR, Long IslandWe've been enjoying an abundance of great imports lately. Nearthe top of the list is the new Smiths single, "Girlfriend In A Coma",which is the new WLIR Screamer Of The Week.... You wouldtend to think follow-up singles imply weaker material than thefirst, or simply a poor decision on someone's part. Neither is thecase with "Lips Like Sugar' from Echo And The Bunnymen. Infact, I can understand the difficulty in deciding whether "NewDirection" or "Lips Like Sugar" should be the first Americansingle. "Lips" continues to get our wholehearted support and Iwill add that it was Screamer Of The Week a month ago. Thestrong get stronger; in fact the non-Lp B-side, "Rollercoaster",is a wonderful little nugget and is also receiving huge phones....This all adds up to one of the best packaged tours of the sum-mer. We are receiving great ticket demand here in New York forGene Loves Jezebel, New Order, Echo And The Bunnymentour.... By the way, our Alison Moyet co -promote at the BeaconTheater on September 3rd sold out well in advance. Our thanksto CBS for all their support.... Also thanks to PolyGram Recordsfor staging a,free WLIR concert with Curiosity Killed The Cat atthe Cat Club. It was a great show and the WLIR listeners en-joyed a free treat!

Don Berns, CFNY, TorontoSince Ivar is still recovering from his ranch bash (three weeksago), I had the enviable responsibility of seeing Roger Watersin concert this weekend. I'll tell you this, it's going to be someroad to hoe for Pink Floyd to do a better show this fall. In twoand a half hours of blistering music and effects, Waters and theBleeding Heart Band (once again including Andy FairweatherLow, Paul Carrack and Mel Collins) created the complete andultimate concert, fostering emotions that ran the gamut from joyto fear, to laughter to hatred (the most provocative anti -war im-ages seen by these eyes in years). One leaves the superb con-

cert drained and exhilarated. If you miss Roger Waters, you'remissing one of (if not the best) concerts of the year.

Ivar Hamilton, CFNY, TorontoNow that I'm back from my vacation in Boston, I want to let youall know how impressive WFNX has become since they boostedtheir signal. They were loud and clear half way to Cape Cod!Thanks to Michael Bright and the rest of the staff for theirhospitality. Also, thanks to John Souchak for the Julian Copeconcert.... Meanwhile, my first priority for records is "Suspicion"from Gene Loves Jezebel. This is probably their strongest effortsince "Desire and has strong crossover potential.... Since ab-solutely no one in the world had no trouble playing "Graceland",there should be no excuse whatsoever for not playing JohnnyClegg And Savuka. We are very excited about this one. Forthose who remember Juluka, the new album has a re-recordingof "Scatterlings Of Africa".

Mike Marrone, WHTG, Asbury ParkTwo records that are being overlooked and it pisses me off:Fatal Flowers' "Well Baby and Tirez Tirez' "Wake Up". They'renot bands with funny hair cuts. They're bands that crank outgood rock and roll!... Other things doing well at WHTG: EchoAnd The Bunnymen's "Lips Like Sugar' continues at #1 with toprequests.... Hoodoo Gurus make a massive jump from mediumto power with "What's My Scene by strength of requests.... PaulKelly moves to power with 'The Execution" and the next trackwe'll be going on is "Before Too Long". This is a record that willbe around a while.... As for John Hiatt, we're on "Memphis InThe Meantime. There must be a reason why John has been onthe top of every critic's list for years and years, and has seenmuch success at a small radio base. Don't you think giving agreat American artist a little bit more than a week to develop isworth it?! Case in point: When "Slug Line" was released, it wasthe #1 most added album the first week out. After one week, itdisappeared. You can't tell me you can't find one song to playoff of his new album.... "Space Cadet" by the Lime Spiderscomes across great on the air. It's a boppin' summertime tune....dB's, "Change With The Changin' Times" is unbelievable....There's so much good stuff out right now it seems redundantto repeat how great all of this music really is. I find it self-defeat-ing to talk about how wonderful the Top 10 records are weekafter week. Why not talk about the records that programmers(including myself) might have passed over in their listen -to pile?

Adam Langley, WBNY, BuffaloWe're really crankin' with promotions this summer. From a bigDead Milkmen show to the Car Push, to our latest venture, theSecond Annual Battle of the Bands. The Battle took place thispast Sunday night on board a retired U.S. Navy Ship, The U.S.S.Little Rock. Seven local Bands battled it out for 5 hours with thewinners, The Real Wigs, cashing in on $500.00 worth of record-ing time at BCMK Studios, Gift Certificates from the House OfGuitars and advertising space in WBNY's "Wave" magazine.Congratulations, guys. Second and third place went to The Rainand The Moment respectively, with over 500 people at the event.Thanks to judges Bruce Moser, Jim Krawzyk, Don Thomasuloand Jim S., formerly of WUWU radio.

Paul Kriegler, KRCK, OmahaThis past week I witnesed one of the greatest concert events ofmy life: Echo, New Order and Gene Loves Jezebel. All threebands turned in fresh performances with the highlight of the eve-ning going to Echo And The Bunnymen when they covered"Twist And Shout". The place was packed with 10,000 scream-ing fans, and all of this was with very little promotion from whatI could gather. Hard Reporters not playing any of these artistsshould rethink their decision because the buzz for these bandsj. on the street. They are the future bands of the '80s. What everhappened to the days of AOR when fresh artists like these wereembraced? As far as Echo And The Bunnymen go, it's reallygreat that Sire pressed a CD single of their new one, "Lips LikeSugar'. Now it's time for all of you to open up your ears to a

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (36)

THEHARD REPORT RADIO COMMENTS

song that deserves all the airplay it can get.... A 1000 hugs tothose at Factory/New York for helping me set up the Now Orderinterview with Peter Hook. What a gentleman! Also, thanks toMark Kates for enduring my constant quierying as to thewhereabouts of Steve Tipp, and to Steve Tipp for just being him-self. It was also a big pleasure to meet Howie Klein. Was thisworth the 8000 mile round trip? You better believe! If this tourcomes to your area, you owe it to yourself to see these bands.They will not disappoint.

Duane Sherman, WTOS, SkowheganAnd the music never stops.... WTOS welcomed the Del Fuegosto the Skowhegan Fair last Friday. The show was great, thecrowd was wild. These guys know how to rock and roll. A spe-cial thank you to Dan Zanes of the Del Fuegos for stopping bythe studios and chatting with me on the air before the show. Idon't know how, but I wound up on the ferris wheel with theband afterward. Keep in mind, I have a fear of heights, but thanksto alcohol.... Saturday night I spent some time with JohnSouchak from Island Records. We enjoyed a seafood dinnerand more Alcohol. Then it was on to a local watering hole tocatch a couple of sets from a great blues band, the Blue Flames.Sunday it was Stevie Ray Vaughan and Double Trouble out-doors at the Villa Park in Old Orchard Beach - and no alcohol!Thanks to Lenny Collins for the tickets.... And now with my lastdying breath I'll tell you my pick of the week: Mojo Nixon andSkid Roper's "Elvis Is Everywhere". I know it's true, becauseElvis is in my paycheck, my Q -Tips, and my toe jam.

Brian Illes, WKFM, SyracuseOn only 4 days of airplay, the new Aerosmith track already racksup Top 5 requests. I've never been much of an Aerosmith fan,but this one knocks me out. "Permanent Vacation" you say? Mybags are already packed.... We're going to try out this new Cut-ting Crew track, even though it's kinda' soft. We've had goodsuccess with the 'Crew so far and perhaps this week be hit #3for them in Central New York.... It took quite a bit of persuad-ing, but we're gonna' try this Great White song, "Rock Me", thisweek.... The Melvin James is smooth, infectious and unques-tionably a hit...but I still think he should change his name.... AndLoverboy's "Notorious" is the best Loverboy release in years.

Glenn Stewart, WHJY, Providence94HJY was proud to host the Columbia/Roger Waters rehears-al party before he opened his nationwide tour here in Rhode Is-land. It was great seeing Bill Hard, Erin, The Harve and BobShow from Hartford, Carter, and the Columbia crew, Rapp Jim,Jay and Sal. Don't miss this show! It is a spectacular multimediaevent.... The Cars have a good solid hit -bound track....Aerosmith's "Dude" looks like a hit. It's got balls and melody....When it comes to Fab T's "Spell", their incredible popularity inthis area means that we had to go deeper on the album and"Spell" fits the The Hooters' "Satellite" is a good track andtheir popularity warrents depth.... Helix's good for the nighttime

head bangin' crowd. We've dealt with them in the past and thekids know 'em.... Cult's "Wild Flower" registers very strong salesin this market, and the remix sounds great.

Rick Van Gil, WLNZ, LansingWith all the superstar product coming out, wouldn't it be grandif the record companies would get together and early release asnippet of the upcoming album? We could put that tiny sampleof what the new album will sound like in a new music promo.We are getting tons of calls on what the new Pink Floyd, JohnMellencamp, Jethro Tull, or whatever will sound like. How aboutgiving us just a little bit of preview music to help sell morerecords by creating a bigger buzz on this heavy -hitter music'?....I'd be an uncool dude if the new Aerosmith didn't go into heavyrotation right away.... And this Cars tune is an End of Summersmasharooni.... Every night before I sleep, I pray to that big plat-ter spinner in the sky to not let this Warren Zevon record die.This is a masterpiece record. I'm also praying that those whoare not playing it will get a wart on their left earlobe.... The Star -ship has a super follow-up. It's great to hear Grace back up frontin the band.... Loverboy is a great tune. The single has really putmore interest back into the group. There's really a lot of anxiousears to hear the whole project. This will be an important albumfor this group, and I've got to say that the reaction so far for thesingle indicates that the album will undoubtedly be wellreceived.

Ty Banks, KQWB, FargoI love the Brandos! As a matter of fact, I've been on a personalcrusade for them since they first came out. We're getting somecalls as roots rock is obviously catching on here as in the restof the country. I'm impressed! And "Gettysburg" sounds greaton the air. Play the Brandos.... Have you checked out the B-sideto Roger Waters' "Sunset Strip" 45? It's a remake of Floyd's"Money" with Paul Carrack on vocals! Should sound wild!... TheCult's "Wild Flower' is pulling calls right away.... The JohnCougar Mellencamp is fantastic. He gives more of the JCM wealready know with "Paper", but that's okay. The song reallyspeaks for itself...It's a smash!... And I'm getting into the Silen-cers. Sounds better every time I hear it.

Phil Colwart, WHMD, HammondWeek 3: I need to hear from someone from PolyGram. Pleasecall 504-345-1070.... Automatics: The Cars and FleetwoodMac.... Baby Bands: Hege V's "House Of Tears".... Hold Outs:Paul Kelly's "Darling", Glen Burtnick's "Follow", andSteppenwolf's "Hold".... Melvin James'"Why" is excellent! SorryI waited a week to add it.... The Dukes Of The Stratosphere onVirgin/Geffen is the best collection on sculpts and hooks of the'60s that I've heard in some time. I understand it's members ofXTC under the pseudonym of Sir John Johns. Psychedelia....

"Scream these words-Can't go home again .

THE ULTRAVIOLETDEBUT ALBUM

ANOTHERVICTIM

1 -ON

RECORDS

Featuring

Can't Go Home Again*

©1987 DKP Productions, Inc. *Produced By Adrian Belew

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (37)

THEHARD REPORT RADIO COMMENTS

Deb Brady, WXXP, PittsburghJust one week on the air and Gene Loves Jezabel's "Suspicion"checks in at Top 5 phones. The song is dynamite.... New Orderhas a definite two-sided hit. "1963" is a real chiller.... If youmissed it the first time around, you get another chance withYello's "Oh Ya". It's fun and will light up the phones.... And if youdo nothing else all week, give the new Squeeze song a spin. It'sa smash.... Please note the adjustment in my music hours: Callswill be taken Monday and Wednesday 10a -1:45p.

Jim Steel, WIOT, ToledoWhat a great weekend. First off, our latest River Rally with "1964:As the Beatles in Concert" attracted more than 30,000 peopleand 30,000 people walked away with looks on their faces as ifthey had seen ghosts. They are as close to the real thing as pos-sible. To top it off, one of if not "the" best Toledo band, The Proof,opened things up. And for the first time in River Rally history thelocal band was brought back for ar encore. If anyone is inter-ested in hearing some local product, get in touch with us. Whoknows, maybe one or two of Toledo's talented bands may beyour next big seller.... Even though the new Cars' tune soundsas if it could have come from any one of their past three releases,it's still very solid and it's still hit bound.... OmarAnd The Howlerscracked the playlist, too, this week. "Dancing In The Canebreak"is rock and roll rhythm and blues at its best.

Slats, WHTQ, OrlandoHere in crime -free Orlando, the Bowie record has done nothingbut sit on the shelves. But with the tour coming to Tampa nextmonth, we'll give "Never Let Me Down" a shot.... RCA is sure ona roll: The Silencers is decent ear candy and the Mr. Mister Lpsounds like high gloss turtle wax, a smooth tune.... Let's get onething straight, The Cars aren't GONNA have a hit with "Girl",THEY'VE ALREADY GOT ONE, period....

Lorraine Rapp, WAQX, SyracuseWe just wrapped up a great promotion with Joe Walsh's "In MyCar. Each time the song was playec a listener received a copyof "Got Any Gum", while the grand prize winner won a Sony carstereo and a bucket of Super Bubble bubble gum. Thanks toJeff Criden and WB. The question is Will you guys pick up thedental bill I've acquired from sampling the goods?... Thanks toElektra for the Motley Crue tickets.... And Congrats to KarenDurcott on her move to Geffen... Sirr on is off to Hawaii and willbe returning Monday, August 31st. Can you say Aloha?... Musi-cally, went on the Mr. Mister this week. It's destined to be a hit,but I wish the intro was more rock and less dance.... The Aeros-mith is great! We've been friends with these guys forever and"Dude" may be the best thing they've ever done; certainly thebest in the past few years... The "Lost Boys" soundtrack is doingwell in sales, and the movie's a hit, so adding Lou Gramm's"Shadows" is a natural for us this weak._

Kevin Vargas, KWHL, AnchorageDef Leppard's "Hysteria" explodes at Anchorage. One three -store chain even sold an incredible 420 cassettes in one week.Keep in mind our population is 235,000. Not a bad start for whatpromises to be the biggest album of the year.... What has to bethe current top album for Alaska so far is Whitesnake and thisrecord is still going strong. Now with us being the only stationin town playing "Is This Love", people are calling up again as-king, "Who's doing this?" That should indicate a few more albumsales on the way.... Great White continues to be a top seller here.And I'm glad to see, nationally, it's doing as good as it did heresix weeks ago.... In these very pages I personally voiced my dis-pleasure with the first Roger Daltrey single, so let me go onrecord as saying "Hearts Of Fire" is an example of the kind ofmusic I'd expect from Daltrey. We'll play this one.

Kurt Hirsch, WBRU, ProvidenceFor those who want to know the answer to the burning ques-tion "Which one is Pink?", I got the answer last week: RogerWaters. His opening show in Providence was stunning. If your

listeners snatched up tix for the upcoming Floyd -In- Exile tour,tell 'em not to miss the real McCoy. Thanks to Sal for thefabulous treatment.... Speaking of shows, we've got a WBRUnight with John Hiatt this Friday. This is my choice for album ofthe year (thus far folks). It has 10 cuts worth of depth.... The har-monic convergence forced us to add Squeeze's new song. Ac-tually, we needed no forcing. "Hourglass" is their hottest tune inyears and we added the import for this weeks Master Blaster.

Scott Borchetta, MTM Records, 615-242-1931What a killer week! What, with those two bands from Boston andall those other major releases out this week, you'd think that anew act like Hege V would' be squeezed out. Well, get backJoJo. 15 adds this week out of the box on "House Of Tears"should tell you something. We're on the phones, we're on theroad, we're in the stores, and we're gonna break this act! Atten-tion retailers: If you'd like a couple of Hege 12 -inches, just giveme a call.

Pam Edwards, KGB, San DiegoNo matter how good their solo projects may be, the membersof The Cars still have some sort of magic that is only capturedwhen they play as a group. This album will be monsterous....Aerosmith is back with a vengeance. This "Dude" sounds like atop 10 hit. Initial reaction has been tremendous. With all thecopycat Aerosmith bands around tis' extremely satisfying tohear the real thing.... San Diego can't get enough of the newHeart album. Virtually every station is on at least two tracks andthe listeners want more. One listen to "Wait For An Answer" andyou'll soon be singing the hook in your sleep.... Mucho thanksto Sue and JB at A&M records for the great time at the BryanAdams show. It's amazing how many hits the guy has.... TheHooters opened the show and, as always, blew me away. Thenew album has performed beautifully. If you guys don't make astop in San Diego this year, our listeners will be cheated....Thanks, also, to Tito and Marshall of the Cruzados for the greatinterview and the X-rated artwork. These guys absolutelysmoked in concert. You haven't lived until you see "Secret AgentMan" sung in Spanish.... That three-inch CD from WarnerBrothers is something special. Forget the cassingle, this thingis amazing.... And to Glen Burtnick: try again. We'd love to hearfrom you.

Ray Gmeiner, Elektra, 213-205-7433This year's model Cars album is "Door To Door". Okay, okay,so "You Are The Girl" might be a little whambly, but you know

it's a hit. If you're looking for the rockers on "Door To Door",check out "Leave Or Stay", "Double Trouble" and "Strap Me In".If those don't rock hard, check out the title track. Wow! Is thatThe Cars? Keep an eye and ear on "Coming Up You" and "GoAway", both future hit singles. Yes, "Door To Door" is deep. Tourstarts Dec. 17th... Gotta Go. See Ya

Lex Staley, WFYV, JacksonvilleI want to talk about the Peter Bardens which got an unbeliev-able number of phone calls on the first play. I've had a chanceto hear the new Aerosmith album and I love that. The singlestarts with heavy play and the reaction is intense! It has justenough different flavor to it to spark their interest. Plus theyknow exactly who it is when they hear it. Sounds just like the"Toys In The Attic" stuff we grew up with.... Obviously the an-nouncement of a concert date spurred the Bowie add. I will go

so far as to say this is the best track on the album and I'm sorrythey waited so long to get to it.... Melvin fames is my favoriteadd of the week. Unmistakable Bill Szymczyk production.... Wealso went with Y&T's "Temptation". Although I would have beenskeptical about this sound a few weeks ago, the success ofEurope's "Carrie" on the format definitely increases the odds onthis one.... Considering: the Brandos. It's a near miss this weekand a solid projection. Also looking at the Starship's "Babylon",and we're watching this Guns 'N Roses very closely.

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (38)

THEHARD REPORT RADIO COMMENTS

Anthony Alfonsi, WDVE, PittsburghHey Dudes!! Aerosmith is back in the saddle and it looks like abig hit!! They've definitely reached higher ground with thisone.... Whenever the Cars come out with a new one it's alwaysdifferent from the last one. "You Are The Girl" shows the promiseof a great Cars album.... Whitesnake is three for three at WDVE."Is This Love" showcases David Coverdale's vocal range. It'sbeen a while since I've heard such a beautiful rock ballad withoutthe use of any power chords.... The Starship's "Babylon" is myfavorite from the album because it lets Grace Slick be herself.I'll be seeing the Starship with the Cutting Crew this weekend....The Cult's "Wild Flower" reminds me of vintage Uriah Heep....and by the time everyone reads this I hope you will all agree that"Cherry Bomb" is the best song off "Lonesome Jubilee".

Greg Mull, WRXK, Ft. MyersThe Aerosmith is the hottest thing on the radio right now. It isimmediately #1 phones and the Lp is killer!! My favorite track iscut 1, side 2, "Hangman Jury".... The Cars Lp should be inter-esting. I hear that the leadoff track may be the only typical Carssong on the package.... The Brandos are hot!! This band hasa feel that transcends format description. "Gettysburg" shouldbe on the radio everywhere.... This week's records that soundgood on the radio are Melvin James and the Cutting Crew. TheCrew will be a tremendous CHR hit and you owe it to youraudience to play this one before the Top 40's do.... The Insidersalbum could be one of the deepest debut albums I've heard,and "Ghost" has jumped to #2 phones overnight. If you're notplaying it, do --and if you are, up the rotation' I Next week'sadds are easy: Pink Floyd, REM, John Mellancamp, John Mel-lancamp, John Mellancamp.

John McCrae, KRQR, San FranciscoThis new Aerosmith track sure reminds me of the "Toys In TheAttic" album. It's like they remembered how to rock and roll.Response is pretty good, with phones almost up in the Def Lep-pard League.... We're playing the T -Birds "How Do You SpellLove" because everyone else is.... Also added the Cruzados"Small Town Love". They've got a good groove here, they'recoming into town --and the song is a natural.... I like the BrianMcDonald. Seems to be a sleeper.... I'm pleasantly surprisedwith the Cars. I was expecting a pure pop washout and insteadI've got something we're not afraid to move to power nextweek.... The Melvin James moves light to medium in just oneweek. It sounds great on the radio. Also upped the Mr. Mister.I was a little hesitant after their last two singles were so soft, butwe have no problem with this one.... Considering: the Cult, Nor-thern Pikes (like that really deep haunting hook), and the BillyIdol next week. "Mony Mony" is the best thing he's put on vinylin ages.

Charlie Logan, WYNF, St. PetersburgAerosmith is just blowing the phones off the hook! How's thatfor a cliched quote? These boys just keep the train a rollin' withthis one. Already #2 Most Requested.... Basically a Bowie re -add on "Never Let Me Down". He's coming to town and we wantto support the show.... Melvin James has one of those songsyou know is a hit after ten seconds --and fall in love with on firstlisten. Where has this guy been?... The Brandos also get a shotthis week. They're one of the new bands I believe in and we'llback it up with airplay on "Gettysburg". Hopefully the audiencewill respond.... We're skipping ahead to the next John Hiatt cut"Have A Little Faith". I saw him in concert and this emotionalnumber blew me away.... Moves: "Alex Chilton" goes light tomedium. Phones are just phenomenal considering it's in lightrotation, so we bumped it.... The Beat Farmers also move up.They're just a band with a real strong buzz in this market andwe're trying to give it the airplay it deserves.

Carter Alan, WBCN, BostonThe Aerosmith album is a fantastic step forward for these Bos-ton Bad Boys, and their best since "Rocks". "Dude" is just anearly indication, and it's not even my favorite on the album.

Aerosmtih are more than alive and well on "Permanent Vaca-tion". They are thriving on rock and roll.... and in other Bostonband news, the big happening is Boston, with an unprece-dented nine nights sold out at the BCNtrum. Homecoming wasspectacular. BCN sent winners and DJ's backstage every night,broadcast from the show, and hosted a cheery Brad Delp onthe air for three hours. It's been "A Boston Weekend" for the pasttwo Saturday and Sundays with tickets, Lp and CD giveaways.

Phil Thompson, KICT, WichitaAside from the new Horn section, the new Aerosmith soundslike their classic material. The horns just add an 80's feel, andSteve Tyler is in fine throat, the best he's sounded in years.... Bythe time this is in print, we will be playing a lot of the new JohnCougar Mellancamp. Thanks to Polygram Records, I got tohear it well in advance of its release, so I know what to expect.I just can't wait to put it on the air.... "Tryin To Dance" will be THEtrack for Tom Kimmel, and his appearance at the UpcomingFarm Aid show in Lincoln Nebraska should win him a lot offans.... Melvin James is an exciting new talent. "Why Won't YouStay" is destined to be a huge record. I think Mr. James will bein our ears for a long time to come. Other new things gettingcalls: Paul Kelly is now a top fiver, The Replacements are get-ting a lot of calls, and Pete Bardens is one of our Most Requestednewer artists.

Kelly Cruise, WEGR, MemphisAerosmith's "Dude" will have you rockin' while the lyrics will haveyou rollin!! With the Run/DMC video a while back and this song,these guys are becoming the Marx Brothers of rock and roll....With all the tracks we just played from the new Def Leppardalbum, "Excitable" seems to be the favorite among the jocks andit's the one that's getting more calls.... The more I hear MelvinJames "Why Won't You Stay" the more it grabs me. The introhas a haunting quality similar to the Scorpions "Still Loving You"

the time the song kicks in the searing vocals, harmoniesand intense beat will have you hooked. Got to get it on soon,along with the Brandos' "Gettysburg".... Special thanks toColumbia's Gene Denonovich and A&M's Craig Lambert andMark Tindell.

Harvey Kojan, KLOL, HoustonSo I go on vacation and all hell breaks loose!! The last time Iwas gone, we added the Cure. This time the Beat Farmers andthe Brandos. Of course, I'll take full credit, despite the fact I was1500 miles away;. And what a vacation it was. Four days in anidyllic Canadian lakeside setting, followed by four days onBrehmer's floor in Chicago. Yeah, I'm a glutton for punishment--record rainfall, no air conditioning and the hapless Cubbiestake three of four from my New York Mets. Thanks, Lin. Lucki-ly, the Bears were in town (Belew's, not Ditka's) and what a con-cert!! The exciting and innovative music was certainly nosurprise, but the energetic, highly entertaining stage show cer-tainly was. Special thanks to Judy Barahal and Kevin Carrollfor the warm reception.... We're still not quite "in love" with "AlexChilton" but it seems right to give it a shot and see if there is in-deed a buzz on this band

Stephen Page, KOME, San Jose,This should be a really, really good Aerosmith song for us. It'salready working well on the phones and I'm looking forward tothe Lp, which I've heard --and it kicks. The whole album is im-pressive (especially the leadoff track) and it sure sounds likethey're having a blast.... Bon Jovi's "Edge of A Broken Heart" isalso showing strong early phones, almost exclusively female....Got that Melvin James in. What a great debut for this guy. I

really have high hopes here.... Loverboy sounds really fine, withpositive response around the station. Nice to hear them backrocking this solid.... Top 5 Beat Farmers calls continue, andwe're also starting to get requests for other cuts.... We're look-ing forward to Paul kelly's appearance at our Expo in two weeks.The track is doing well for us, with action in all dayparts.... Andthe Bardens is getting great reaction with almost exclusively

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (39)

THEHARD REPORT RADIO COMMENTS

evening play, doing really well for people who need that fix ofearly progressive rock and roll.... Considering: I think DavePerkins has a good shot with "You Can Make Me Feel".

Dale Miller, KATP, AmarilloIt can also be said of Aerosmith, Thrie is on their side. Theseguys just keep getting better and better, and they're not afraidto expand their sound. Horns on the new single? And it works!Can't wait for the new album Faster puss*cat is causing aneven faster audience reaction.... Thanks to Mark at Geffen forthe recent Y&T show. I'm still talking about it. This band is a mustto see in concert. One of the best live sounds I've heard in along time. Y&T is definitely on the horizon.. This is our thirdsingle from Hege V and we expect it to do really well, just likethe previous two --both of which had solid audience reaction....Billy Idol was a late arrival and its great to hear him do this clas-sic track live.... Helix is real strong in Amarillo, and has been foryears. We've already gotten instant reaction on what I think ;isone of their best out of the box singles.... and personal favoritesthe dB's are already starting to show some audience interest.

Tim Jeffreys, KAZY, DenverHey, I love this Aerosmith, their best since "Walk This War....Happy to get "Wishes" from Jon Butcher on, especially in heavyrotation. I recently had the chance to meet this artist, and letme tell you, he is as sincere as he is talented.... The MelvinJames record is a killer. I think the production alone is almostreason to play it. Talk about developing a hook! "Electric" hasbeen one of my favorite records this year, so "Wild Flower wasan easy add for me. I loved it when they trashed their equipmenton Joan Rivers.... MoFo tests on Great White continue. It's cur-rentlythe strongest testing record we've got.... Strong early callson the Hooters "Satellite". Nice to have them by the station lastweek... and Faster puss*cat is still the #1 requested tune onthe station.... Congratulations to Ray Gmeiner and MichaelLinehan on their promotions, also thanks to Michael Prince,Sean Coakley, Jay Ziskrout and Marko for coming by the sta-tion this past week.

Karen Anderson Small, WGIR, ManchesterTwo of New England's finest bands have come out with somefine records: The Cars' "You Are The Girl" keeps sounding bet-ter and better, and Aerosmith's "Dude (Looks Like A Lady)"easily rank right up there with their best.... Speaking of NewEngland, we'll give a new New England artist a shot this week.Scott Folsom hails from Portland, ME, and has put out a recordwith a slight Bryan Adams tinge to it.... Paul Kelly's "Darling ItHurts" is a pure, fun record.... The Starship played here inManchester last weekend as part of the Concert On The Riverseries. I was impressed. They put or a such a good show. Thesong roster read like a greatest hits package which they beltedout to great audience response. Sure had a wonderful time. Upnext on the River is Neil Young.

Charlie Wrobbel, KTCL, Ft. CollinsI was first turned on to Tackhead from a tape I received at theNMS. I thought it was one of the hottest things I'd heard in ages.Still do and it's on the air.... New on the air is the Wildflowers,Dead Milkmen, and a fusion band called Man Jumping.... A lotof response to New Order and true fans will love the compila-tion.... Dumptruck has a great single. This should get a lot ofreaction. A huge welcome back to the dB's. "Change" is the cut.

Erin Riley, WMMR, PhiladelphiaEvery time a new Aerosmith record comes out, I revert back

to my teen years -- where I could be found climbing thru thecrowd on the floor of the Spectrum just to get close enough tosee if those lips were real. Aerosmith was always the perfectblend of blues, funk, and hard rock. They, in a way, defined myyouth. When I saw them at the Texxas Jam, I was stunned. Itlooked as though ten years were taken off their faces. "Aeros-mith tan?" UNBELIEVABLE. They lock like they spent the yearat a Spa. They played like it was a gig from '73. "Dude (Looks

Like Lady)" is just what I needed from Aerosmith. They are backin that fine style I love so much.

Kim Alexander, WHCN, HartfordWhat a thrill! I spent 60 seconds of my weekend on stage at

the Hartford Civic Center. Apparently, someone in the RogerWaters camp thought it would be a great idea to tie local air per-sonalities into the "Radio Kaos" theme. In front of thousands, Iplugged a Labor Day Blood Drive that WHCN will sponsor laterthis month. Shoot, it was almost as much fun as singing withREO.... I always thought Glen Burtnick's "Follow You" was apretty cool tune -- but the Lp has made me a real, live believer.Sure, some of the tracks are Bryan Adams-ish, but there areplenty of times where Glen is Glen -- and no one else. Every timeI hear "Until the Day Your Ship"', I melt. Can't wait to hear himlive.

Paul Nelson, WWCT, PeoriaAerosmith! What a shock. "Dude" is the best thing they've done

since "Rocks". The horns and the tasty guitar solo are a nicetouch.... After some hesitation, the Beat Farmers pull top 5phones after one week. Also, great phones continue for JonButcher and the Insiders. The co -writer of "Ghost on the Beach",Johnny Siegel, is a Peoria native and his mother is responsiblefor at least one of those calis. She and Eunice Richrith (Gary'smom) should get together. She has been requesting REO's "InMy Dreams", which continues to pull top 5 phones Thanksto Louis Heidlemeir of Elektra for the Call/Furs show. Both wereimpressive. All the "haircuts" and agriculture displays made aweird combination at the State Fair.

T -Bone, KISS, San AntonioAerosmith is f**king outta sight, man! First time I played it I

thought the CD was mis-tracking; every time I play it, it's instantparty.... What the hell, nobody else is gonna talk about thisWASP record so I will. They're loud, rude, crude and obnoxious,and our nite time rockers love 'em.

Beth Kepple, WKLS, AtlantaHow is the new Aerosmith? So hot that within the first 24 hoursthat we had it someone ripped off the CD! Inside the jacket wasa sound effects Cd from the production studio and inside thatCd box - nothing. The engineers tore the studio apart to see ifit had fallen into a crack somewhere, the programming stafflooked in every CD box in the station to see if it was misfiled,every jock was given the third degree, every CD player in thestation was checked and found to be empty. "Dude Looks LikeA Lady" vanished and to this day we haven't found it. I confessif I had a Cd player I'd be guilty of stealing it. It's the best Aeros-mith song I've ever heard. End of the story'?.... Geffen comesthrough. Thanks to George Cappellini and wife for letting ussend a courier to their home and giving up their own personalcopy.this is final corn fir the day

Mike Keller, KQDS, DuluthThe new Aerosmith has the 80's feel with a 70's influence thatour listeners want more of. These Dudes will get plenty of nighttime airplay.... The Cars are cruisin' as talk on the street is verypositive for "You Are The Girl".... Def Leppard is alive and wellin Duluth as "Hysteria" debuts #1 in sales after one week ofairplay. "Animal" is garnering the same phones as "Women", withits mass acceptance, "Animal" goes to heavy.... Special thanksto Bruce McGregor and Dave Hamilton. You guys are great!

Radio Reports...

Monday and Tuesday

10am - 7pm EST

609-654-7272

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (40)

THE REPORTSCFNY TORONTO ONTP.D. DON BERNSPH: 416-453-7452MUSIC:MON EVECALLS:MON-FRI 9- 5

MEDIUM ADDSGENE LOVES JEZ SUSPICION

POWERECHO/BUNNYMENILIVING/DAY STROGER WATERSTHE SILENCERSWARREN ZEVONHEAVYABCLA SAMBA STTHE BEARSIBOLSHOITHE CALLERASUREGARY NUMANNEW ORDERPET SHOP BOYSTHE SAINTS

yEmum1'10,000 MANIACSLONELY/EYESORENEW MODEL ARMYANDY SUMMERSTHE CUREFLESH FOR LULUGRATEFUL DEADGO-BETWEENSKID CREOLEMOJO NIXONNEIL YOUNGPETE HARDENSSTAN CAMPBELLURBAN BLIGHTeXYELLO

LIGHTDEAD MILKMENFAITH NO MOREFIGURES/BEACHHURRAHICICLE WORKSJESUS MARY CHLUCKY 7PAUL KELLYPAT METHENYPUSHTWANGERSSIOUXSIE

LPWHERERADIOLPLP

WHENBAMBALPPLEASELPVICTIMRADIOFAITHSINTEMPLE

LPLPLPLPLPLPLPLPLPELVISLP

DREAMSLP

LP

LPLPLPLPJANEHAPPYLPLPLPEPSONG

NORTHERN PIKESICEHOUSEHUGH MARSHAAKANE GANGFMGLORY CHAINSECESSIONACTDEACON BLUEIN TUA NUAMESSENJAHMISSIONIN DEMANDEAR CANDYMENTECCACHRISTIANSCABERET VOLTAIREWEATHERMENDOLPHIN BROS.DURUTTI COLUMNFAT BOYSJOHNNY CLEGG/SAV.

CFOX VANCOUVER BCP.D. JOHN BEAUDOINM.D. KAREN HEWKOPH: 604-684-7221MUSIC:TUE AFTCALLS:FRI-MON

WNW ADDSDEF LEPPARDMR. MISTERPAUL KELLYROCK AND HYDEBLUE RODEOWHITESNAKE

POWERILA SAMBA STBRYAN ADAMSEUROPEFLEETWOOD MACIGRATEFUL DEADHEARTHUEY LEWIS NEWSJ.C. MELLENCAMPSTARSHIPWHITESNAKEHEAVY38 SPECIALIDAVID BOWIETHE CARSCROWDED HOUSEHEARTHOOTERSTOM PETTYROGER WATERS

ME2DIUMBRYAN ADAMSCRUZADOSEIGHT SECONDSFROZEN GHOSTGRATEFUL DEADGREAT WHITEHAYWIREHAYWIREHAYWIREJON ASTLEYLOVERBOYLIVING/DAY STRICHARD MARXNEW REGIMENORTHERN PIKESPAUL JANZPAUL JANZREFUGEETHE SILENCERSSUZANNE VEGAJOE WALSHLIGHTHOOTERSOMAR/HOWLERSSTEPPENWOLF

(CD)

(CD)

LPCRAZYLP12"12"LPLP12"LPLPLPLPBAREFOOTLPLPLPLP12"POISONLPEPLPLP

ANIMALSOMETHINGDARLINGMIDDLELPIS

SUMMERTIMEVICTIMCARRIELITTLETWHOOUCHDOINPAPEROVERHERE

BACK

YOUNEVERWORLDGIRLJOHNNYMIXEDSUNSETSTREETS

REMEMBRANCBEDSINCEREPROMISESHELLROCKDANCEOHSEPARATEJANENOTORIOUSWHERESHOULDLOVETHINGSCRSENDSURVIVALPAINTEDSOLITUDECAR

SATELLITEBORDERHOLD

CHEZ-FMOTTAVVAONTARIOP.D. STEVE COLWILLM.D. GREG TORRINGTONPH: 613-563-1919

HEAVY ADDSJOHN HIATT MEMPHISMEDIUM ADDS10,000 MANIACS JACKAEROSMITH DUDEDEF LEPPARD WOMENMR. MISTER SOMETHINGLIGHT ADDSGLEN BURTNICK FOLLOW

HEAVY*AHA*LA SAMBA STLA SAMBA STBEV HILLS COP 2BEV HILLS COP 2DAVID BOWIETHE BOXCHALK CIRCLESTEVE EARLEJOHN FARNHAMFLEETWOOD MACFLEETWOOD MACGRATEFUL DEAD*GRATEFUL DEAD

LIVINGSAMBASUMMERTIMEDEEPTHERETIMEPEOPLEARTIFICIALSWEETPRESSUREMIDNIGHTSEVEN (CD)HELLTOUCH

GO WEST LOOKHEART WHOJOHN HIATT THINGJ.C. MELLENCAMP PAPERPAUL KELLY BEFOREPAUL KELLY LASTROCK AND HYDE TOUGHERTHE SILENCERS PAINTEDSTARSHIP TRANSSUZANNE VEGA NIGHTSUZANNE VEGA SOLITUDEU2 FOUNDU2 SPANWARREN ZEVON BOOMMEDIUMABC WHENDAVID BOWIE NEVERTHE CALL LPCUTTING CREW ONE

*DCRUZADOS

ABEDEF LEPPARDANIMALDANNY WILSON PRAYERSTEVE EARLE IECHO/BUNNYMEN BEDFABULOUS THIRDS STANDTHE FIXX SCAREDFROZEN GHOSTGOWAN AWAKEHAYWIREHOOTERSHOOTERSCHRIS ISAAKLOST BOYS STLIVING DAY STON*MARILL

DANCEJOHNNYSATELLITEBLUEGOODWHEREINCOMMUN

MONDO ROCK LOVENEW REGIME LOVETHE OTHER ONES HOLIDAYPETE HARDENS DREAMSPAT METHENY LASTWHITESNAKE HEREWARREN ZEVON DETOXLIGHTBEAT FARMERS DARKTHE CULT . DEVILTHE CURE HEAVENECHO ERTNEN GAME

GIVE

CHOM-FM MONTREAL QUEP.D. LAN MAC LEANM.D. BENOIT DUFRESNEPH: 514-935-2425 '

(CD)

(CD)

HEAVY ADDS

FLEETWOODYOU

MAC LITTLELIVING/DAY ST IFMR. MISTER SOMETHINGSUZANNE VEGA SOLITUDE

MEDIUM ADDSLOVERBOY NOTORIOUS

POWERABC WHENCROWDED HOUSE WORLDJOHN FARNHAM PRESSUREtJ.C. MELLENCAMP PAPER,SIMPLY RED INFIDELITY

HISUZANNE VEGA LUKAEAVYDAVID BOWIE NEVERB. SPRINGSTEEN FIREEDDIE MONEY WANNAEURYTHMICS MIRACLEFLEETWOOD MAC SEVENGRATEFUL DEAD TOUCHHEART WHOHUEY LEWIS/NEWS DOINLEVEL 42 RUNNINGRICHARD MARX MEANTHE SILENCERS PAINTEDSTARSHIP OVERU2 SPANISHMEDIUM38 SPECIAL BACKBON JOVI DEADTHE BOX PEOPLEBRYAN ADAMS VICTIMCHALK CIRCLE 20THCOREY HART GOODDEF LEPPARD ANIMALFLEETWOOD MAC MIDNIGHTFROZEN GHOST ENDGOWAN AWAKEHOOTERS JOHNNYHUGH MASEKELA PURPLETHE JITTERS HARDDANIELLE LAVOIV HUMANLOST BOYS ST GOODMICHAEL GREE RAINNORTHERN PIKES TEEN

OLQ TORONTO ONTP.D. BOB MACKOWYCZM.D. ANDY FROSTPH: 416-967-3445CON: B -A -D -ECALLS:WED

HEAVY ADDSAEROSMITH DUDEPAUL CARRACK SHEDMEDIUM ADDSPAUL KELLY DARLINGROGER WATERS WHOTHE SILENCERS PAINTEDLIGHT ADDSHAYWIRE BLACKHAYWIRE THINKINGHELIX DREAMHELIX NEVER

HEAVYTHE CARS YOUCHALK CIRCLE 20THICRUZADOS BEDDEF LEPPARD ANIMAL

/FROZEN GHOST PROMISESGRATEFUL DEAD TOUCHGREAT WHITE ROCKHHEARTAYWIRE GIRLDANCE

HELIX W LHOOTERS JOHNNYJ.C. MELLENCAMP PAPERTHE JITTERS LASTLOVERBOY NOTORIOUSNEW REGIME LOVE,NORTHERN PIKES THINGStU2 STREETSWHITESNAKE HERE

MEDIUMBACK/BEACH ST PIPELINEBEAT FARMERS DARKDAVID BOWIE NEVER

EXCITABLEDEF LEPPARD GODSDEF LEPPARD HYSTERIADEF LEPPARD LOVEDEF LEPPARD SUGARDEF LEPPARD WOMENDIO DREAMERFABULOUS THIRDS SPELLFASTER puss*CAT CHANGEGLEN BURTNICK FOLLOWGRATEFUL DEAD HELLGRATEFUL DEAD PUSHGRATEFUL DEAD WEST

SAMMY EASYYHAGAR BOYS

ARHEARTHEART WAITRICHARD MARX SHOULDMICHAEL WHITEOMAR/HOWLERSROGER WATERSSTARSHIPU2TOM KIMMEL

U2WHITESNAKEWHITESNAKEWHITESNAKELIGHTTHE BOXBRYAN ADAMSBRYAN ADAMSBRYAN ADAMSCHALK CIRCLECHALK CIRCLEFROZEN GHOSTGOWAN

PSYCHOMETRDANCINGSUNSETOVERFREEDOMRUNNINGTREECRYINGGIVEIS

PEOPLENATIVEONLYREMEMBRANCCOUNTSEMPTYSOLDIERSLIVING

(CD)

KATP AMARILLOP.D. JACK RANDALLM.D. DALE MILLERPH: 806-374-1637MUSIC:MON AFTCALLS:FRI 3- 5

HEAVY ADDSAEROSMITH DUDEMINIMA ADDSBILLY IDOL MONYTHE YOUD.L.

CARSJONES BONNIE

FASTER puss*CAT CHANGEHEART WAITHEGE V HOUSEHELIXIQ PROMISESMARILLION SUGARMR. MISTER SOMETHINGTOM KIMMEL DANCE

HEAVYBEAT FARMERS DARKIDAVID BOWIE NEVER

JON BUTCHER WISHES 01BRYAN ADAMS VICTIM

DEF LEPPARD WOMEN

GRATEFUL DEAD HELL 0;EUROPE CARRIE

*GREAT WHITE ROCKSAMMY HAGAR BOYStINSIDERS GHOSTJ.C. MELLENCAMP PAPER S'8;

JON ASTLEY JANELOVERBOY NOTORIOUSRICHARD MARX SHOULD

DARLINGPAINTED (CD)ISN'TSTREETS (CD)CAR (CD)HERE

IPAUL KELLYTHE SILENCERS'PATTY SMYTHU2JOE WALSH*WHITESNAKEMEDIUM*ACE FREHLEY ROCKTHE BEARS FEAR (CD)BRIAN MCDONALD LIFETHE BRANDOS GETTYSBURGTHE CAUSE LOVING

CROWDED HOUSE WORLDTHE CULT WILD

JUST (CD)CDCD

co*ck ROBIN

ROGER DALTREY FIRE'S LE

DIO DREAMERDAVE PERKINS YOU

JOE ELY LORD(CD)ELTON JOHN CANDLE

ENVY BELIEVE

FLEETWOOD MAC LITTLE 0;FABULOUS THIRDS SPELL

FIRE TOWN RAINGLEN BURTNICK FOLLOW (CD)GRIM REAPER LUSTGU*SAMMYNS NHAGAR'ROSES

HOMEWELCOME(CD)

JESSE C. YOUNG HIGHWAYLIVING/DAY ST WHEREMASON RUFFNER WORLD (CD)MELVIN JAMES WHYM. TOMLINSON BELIEVENEIL YOUNG LONELY (CD)OMAR/HOWLERS MANOUTFIELD HEART

TOM PETTYREFUGEEMIXEDCDCD

SURVIVAL CD

PETE HARDENS DREAMS

REPLACEMENTS ALEXROGER WATERS SUNSETGREGG ROLIE HANDSROBERT VAUGHN JUSTICE (CD)STARSHIP BABYLON

SUZANNE VEGA SOLITUDE 0;STEPPENWOLF HOLD

KATT OKLAHOMA.CITYP.D. PAT WELSHM.D. SCOTT DOUGLASPH: 405-848-0100CALLS:MON-THU 2- 6

POWER ADDSTHE CARS YOUHEAVY ADDSAEROSMITH DUDEMEDIUM ADDSFABULOUS TBIRDS SPELLMARILLION SUGAR

POWERJON BUTCHER WISHES (CD)DEF LEPPARD ' ANIMALFLEETWOOD MAC MIDNIGHT (CD)J.C. MELLENCAMP PAPER (CD)HEAVYCRUZADOS BED (CD)DEF LEPPARD WOMENGRATEFUL DEAD HELL CDSAMMY HAGAR BOYS CDJON ASTLEY JANE CDRICHARD MARX SHOULD CDTOM KIMMEL FREEDOM CDU2 STREETS CDtWHITESNAKE IS CDMUM

ACE FREHLEY INTOLA BAMBA ST SAMBA CDBACK/BEACH ST CATCH CDBEAT FARMERS DARKBRYAN ADAMS VICTIMCROWDED HOUSE WORLD (CD)ROGER DALTREY FIREDEF LEPPARD TEAR CDDIO DREAMER CDEUROPE CARRIE CDGREAT WHITE ROCK CDHEART WHO CDHOOTERS JOHNNY CDINSIDERS GHOSTJ.C. MELLENCAMP NEVERLOVERBOY NOTORIOUSMR. MISTER SOMETHING CD

ROGER WATERSTHE SILENCERSPATTY SMYTHSTEPPENWOLFJOE WALSHWHITESNAKE

SUNSET CDPAINTED CDISN'T CDHOLDCAR 0;HERE

KAZY DENVERP.D. TRIP REEB/OMM.D. TIM JEFFREYSPH: 303-759-5600CON: JEFF POLLACKMUSIC:TUE AFTCALLS:THU 12- 5

HEAVY ADDS*AEROSMITHJON BUTCHERTHE CARSSAMMY HAGARMELVIN JAMES

MEDIUM ADDSTHE CULT

DUDEWISHESYOUEAGLESWHY

WILD

POWERGRATEFUL DEAD TOUCHIGREAT WHITE ROCKHEART WHOJ.C. MELLENCAMP PAPERLOST BOYS ST GOOD

HEAVYBEAT FARMERS DARKBRYAN ADAMS VICTIMCRUZAS BE*DEF LEPPARD ANIMALDEF LEPPARD WOMENFABULOUS TBIRDS SPELLDAN FOGELBERG MATTERGRATEFUL DEAD HELLHOOTERS JOHNNY

*HOOTERS SATELLITEINSIDERS GHOSTJON ASTLEY JANE*LOVERBOY NOTORIOUSOMAR/HOWLERS HARDTOM KIMMEL FREEDOMU2 STREETSJOE WALSH CARWHITESNAKE IS

CDCDCDCDCD

ISEi

piCD

CD)

CDCDCDCDCD

MEDIUMDIO DREAM

*FASTER puss*CAT CHANGERMOTLEY CRUE WILDTESLA ROCKTNT STARWHITESNAKE CHILDREN

KBAT ODESSAP.D. FRANK HALLM.D. JOHN ROBINSPH: 915-563-2121CON: GEORGE WILLIAMSMUSIC:TUE AFTCALLS:MON 4- 6

MEDIUM ADDSAEROSMITH DUDETHE CARS , YOUTHE CULT WILDGLEN BURTNICK FOLLOWLOVERBOY NOTORIOUSMR. MISTER, SOMETHINGURGENT TAKE

HEAVYCONCRETE BLONDE TRUEIBRYAN ADAMS VICTIM

DOS BED*DEFCRUZA LEPPARD WOMENGRATEFUL DEAD HELLGRATEFUL DEAD TOUCH

*GREAT WHITE ROCKHEART WHOHOOTERS JOHNNYJ.C. MELLENCAMP PAPER*JON ASTLEY JANE,TOM PETTY MIXEDTU2 .STREETSWHITESNAKE HEREMEDIUM*LA BAMBA STBEAT FARMERSDAVID BOWIEJON BUTCHERCHARLIE DANIELSCROWDED HOUSEDEF LEPPARDDIO

*EUROPEFABULOUS THIRDSFLEETWOOD MACGRATEFUL DEADGRATEFUL DEADSAMMY HAGARSAMMY HAGARHOOTERSINSIDERSJASON/SCORCHERSJUDAS PRIESTLIVING/DAY STMARILLIONRICHARD MARXMOTLEY CRUEMELVIN JAMESPAUL KELLYROGER WATERSTHE SILENCERSSTEPPENWOLFSUZANNE VEGATESLAJOE WALSHWORLD PARTYWARREN'ZEVON

KBCO-FM BOULDER

BAMBADARK

WISHES

WORLDBOGGED (CD)ANIMALDREAMERCARRIESPELLLITTLE

WEST(CD)PUSH

BOYSHOMESATELLITEGHOSTSHOTGUNANOTHER

SHOULDWILD

INCOMMUN

CD

WHERE

WHYDARLINGSUNSETPAINTED (CD)HOLD

(CDROCKSOLITUDE (CD))CAR

DETOX 01ALL

19CDCD

CDCD

CDCD

CDCDCD

(CD)

CD

P.D. JOHN BRADLEYM.D. DOUG CLIFTONPH: 303-444-5600CALLS:WED-THU 3- 5

HEAVY ADDSTHE CARSGRATEFUL DEADROGER WATERSU2MEDIUM ADDSTHE CUREMARILLIONSQUEEZESUZANNE VEGALIGHT ADDST. LAVITZ

YOUHELLSUNSETSTREETS

HEAVENTORCHHOUREYE

LP

HEAVYBEAT FARMERS DARKDAVID BOWIE NEVER CDJON BUTCHER WISHESCRUZADOS BEDJOHN HIATT THANK CDt HOOTERS JOHNNYJ.C. MELLENCAMP PAPER (CD)LIVING/DAY ST WHEREPETE HARDENS DREAMSTOM PETTY MIXED CDTHE SILENCERS PAINTED CDWARREN ZEVON DETOX CD

MEDIUM10,000 MANIACS JACKLA SAMBA ST SAMBA (CD)THE BEARS TRUSTBUCKWHEAT ZYDE. LPTHE CALL WANNA (CD)CHARLIE DANIELS BOGGEDDB'S LPECHO/BUNNYMEN NEWELEANOR BAHJOE ELY LPFABULOUS THIRDS SPELLFIGURES/BEACH STARS

RA

(CD)

FIRE TOWN ININSIDERS GHOST CDJOAN BAEZ BIKOJON ASTLEY JANE 01STEVE JONES MERCYLARRY CARLTON HOMEMASON RUFFNER WORLDMR. MISTER SOMETHINGIPAT METHENY LASTREPLACEMENTS HARDLYROBERT VAUGHN JUSTICEJOE WALSH CAR (CD)LIGHTTANGERINE DREAM CENTURY

KBER SALT LAKE CITYP.D. KATHERINE BROWNM.D. TRISHA GRIFFITHPH: 801-322-3311CON: DAVE LOGANMUSIC:TUE MORCALLS:MON 2- 5

HEAVY ADDSAEROSMITH DUDETHE CARS YOUMEDIUM ADDSDAVID BOWIE NEVERCHARLIE DANIELS BOGGEDWHITESNAKE ISLIGHT ADDSFASTER puss*CAT CHANGE

HEAVYtBEAT FARMERS DARKCROWDED HOUSE WORLDCRUZADOS BEDDEF LEPPARD WOMENIGRATEFUL DEAD HELLGREATHEART WHO

WHITE ROCK

HOOTERS JOHNNYJ.C. MELLENCAMP PAPERMR. MISTER SOMETHINGOUTFIELD SINCETOM PETTY MIXEDROGER WATERS SUNSETSTARSHIP OVERU2 STREETSMEDIUMTHE CALL WANNACUTTING CREW LOVEco*ck ROBIN JUSTDEF LEPPARD ANIMALDEF LEPPARD HYSTERIAEUROPE CARRIEFABULOUS THIRDS SPELLFLEETWOOD MAC LITTLEGRATrpnr. npAn PUSH

August 21 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (41)

THE REPORTSGRAThruL DEADSAMMY HAGARSAMMY HAGARSAMMY HAGARJOHN HIATTHOOTERSINSIDERSLOVERBOYLIVING/DAY STMOTLEY CRUENEIL YOUNGOMAR/HOWLERSPETE BARDENSPAUL KELLYGREGG ROLIETHE SILENCERSSTARSHIPWARREN ZEVONLIGHTACE FREHLEYDIOTNTYier

KBLE DES MOINES

WESTBOYSEAGLESHOMETHINGSATELLITEGHOSTNOTORIOUSWHEREWILDLONELYM ANDREAMSDARLINGHANDSPAINTEDBABYLONDETOX

ROCKDREAMERSTARTEMPTATION

P.D. RON SORENSONPH: 515-288-3033MUSIC:TUE MORCALLS:TUE-FRI 12- 4

LIGHT ADDSHWOOD BEYOND LPBELOUIS SOME LPBUCKWHEAT ZYDE. LPTHE CARS . YOUCURIOSITY/CAT LPD. MASON LPDUKE/STRATOSPHR LP

POWERS LPCRUZADDANNY O

WILSON LP (CD)GRATEFUL DEAD LPGO LPJOHNWEST HIATT LPALISON MOYET LPROGER WATERS LP

WENDY WALDMAN LPSUZANNE VEGA LP

i°3

WARREN ZEVON LPHEAVYCUTTING CREW LPSTEVE EARLE LP(JOE ELY LPFLEETWOOD MAC LP (CD)DAN FOGELBERG LPGREGG ALLMAN LP (CD)JESSE C. YOUNG LPJUDE COLE LPMARILLION LPRICHARD MARX LPM. TOMLINSON LPNEIL YOUNG LPPAUL KELLY LPOCK AND HYDE LP 0U2 3

RLP

MEDIUM(10,000 MANIACS LPBEANIE TAUPIN LPFABULOUS THIRDS LPCHRIS ISAAK LPT. LAVITZ LPLEVEL 42 LPLOS LOBOS LP (CD)NEVILLE BROS. LP (CD)SHELLYAN ORPHAN LPSTARSHIP OVERSTYLE COUNCIL LPJOE WALSH LPWASHINGTON SQ. LPLIGHTBACK/BEACH ST LPTHE BRANDOS GETTYSBURGBONNIE HAYES SOMEJ.C.IVMEGLLENCAMP PAPERLIN/DAY STTHE MONKEES HEART (CD)NANCI GRIFFITH NANCYPETER TOSH LPGREGG ROLIE HANDSSTEVE GOODMAN LPSTEPPENWOLF HOLDPETE WYLIE SINFULXTC LP

KEPI DENVERP.D. GABE BAPTISTEM.D. JOHN EDWARDSPH: 303-572-6255MUSIC:FRI MORCALLS:MON-FRI 9- 5

HEAVY ADDS

THE CBRYAN

ARSADAMS VICT

YOUIM

MEDIUM ADDS38 SPECIALAEROSMITHMR. MISTERTOM KIMMELY&T

HEAVY*DISORDERLIES STIGLEN BURTNICKGREAT WHITESAMMY HAGARHEARTHOOTERS*HOOTERSINSIDERSJ.C. MELLENCAMPLOVERBOYMELVIN JAMESOUTFIELDPAUL KELLYTHE SILENCERSU2WHITESNAKEMEDIUMROGER DALTREYDEF LEPPARD

*DEF LEPPARDDIOFASTER puss*CATGRATEFUL DEADHEARTJON ASTLEYLOST BOYS STRICHARD MARXMOTLEY CRUEROGER WATERS

URGENTJOE WALSH

CD

SAME CDDUDE CDSOMETHINGANCE CDD CDTEMPTATION CD

EDGEFOLLOWROCKHOMEALONEJOHNNYSATELLITEGHOSTPAPERNOTORIOUSWHYHEARTDARLINGPAINTEDWITHIS

FIREANIMALWOMENDREAMERCHANGETOUCHGIRLJANEGOODSHOULDWILDSUNSETSTARSTREETSTAKECAR

KCMU. SEATTLEP.D. SHAWN SPLANEM.D. FAITH HENSCHELPH: 206-543-4680MUSIC: MON AFTCALLS: MON 11-4

ADDSNICE STRONG ARMOPALTHELONIOUS MONSTERFOLK DEVILS

HEAVYLIME SPIDERSCONTROLLED BLEEDDER PLANDUST DEVILSGO BETWEENSHASIL ADKINSLONELY/EYESOREMAD DADDYSSCREAMING TREESEDWARD KA SPELFOR YOUR EARS ONLYLEE SCRATCH PERRYMINIMAL COMPACT

CDCDCDCDCDCDCD

CDCDCDCD

CD

CDCDCDCDCDCDCDCDCDCDCD

CD

LPLPLP12"

LPLPLPLPLPLPLPLPLPLPLPLPLP

SONIC YOUTHTHAT PETROL EMOTIONBUCKWHEAT ZYDECOTHE CUREEBENZER OBEYTOM VERLAINEJOHN HIATTYOUNG GODSTEN YEARS AFTER...CLIVE PIGMYTH 1 COMPILATION

MEDIUMSBUTTHOLE SURFERSDR NERVEGONE TO EARTHLIVE SKULLCLEANERS FROM VENUSJAMES COTTONROYAL CRESCENT MOBTROUBLE FUNKECHO/BUNNYMENTHATCHER ON ACID

TOP 5 INDIES:HASIL ADKINSSCREAMING TRESSSONIC YOUTHCONTROLLED BLEEDINGDER PLAN

KDJKMODESTOP.D. MARK DAVISM.D. BEAVER BROWNPH: 209-869-2594MUSIC:TUE MORCALLS:MON-THU 10

LPLPLPLPLPLPLPLPLPLPLP

LPLPLPLPLPLPLPLPLPLP

HEAVY ADDSTHE CARS YOU

MEHDIUMEARTADDSWAIT

LIGHT ADDSAEROSMITH DUDEWC TEMPTATION

POWERCRUZADOS BEDDEF LEPPARD WOMENGRATEFUL DEAD TOUCH (CD)*GREAT WHITE ROCKHOOTERS JOHNNYHEAVYBEAT FARMERS DARK(DAVID BOWIE NEVERBRYAN ADAMS VICTIMTHE CALL WANNA.DEF LEPPARD EXCITABLE.DIO DREAMERHEART WHO 03J.C. MELLENCAMP PAPER*LOVERBOY NOTORIOUSROBERT VAUGHN JUSTICETHE SILENCERS PAINTEDWHITESNAKE (CD)

MEDIUMHERE

ACE FREHLEY 03*JON BUTCHERROCKWISHES

CUTTING CREW LOVECHARLIE DANIELS BOGGEDTHE CULT WILD (CD)DEF LEPPARD ANIMALDEF LEPPARD HYSTERIAFABULOUS THIRDS SPELL 01FLEETWOODMAC LITTLEGLEN BURTNICK FOLLOWGRATEFUL DEAD WEST (CD)SAMMY HAGAR HOMEHOOTERS GRAVEYARDHOOTERS SATELLITEMARILLION SUGAR (CD)RICHARD MARX SHOULDMOTLEY CRUE WILDMR. MISTER SOMETHINGOMAR/HOWLERS DANCINGTOM PETTY MIXEDPOISON FORGETREFUGEE SURVIVALROGER WATERS SUNSETTESLA ROCK 01

SDKS MESAP.D. CHUCK GEIGERM.D. STEVE TRELLAPH: 602-897-9300MUSIC:TUE AFTCALLS:MON-TUE 03-05

HEAVY ADDSAEROSMITH DUDETHE CARS YOUMEDIUM ADDSBRIAN MCDONALD LIFE

UGHMELVIN JAMES WHY

TADDSGUNS N' ROSES WELCOMESAMMY HAGAR HOMEPETE HARDENS DREAMSSTARSHIP BABYLON

WARREN ZEVON DETOX

HEAVYCHARLIE DANIELS BOGGEDCRUZADOS BEDDEF LEPPARD WOMENDIOGLEN BURTNICK FOLLOWGREAT WHITE ROCKSAMMY HAGAR BOYSHOOTERS JOHNNY(INSIDERS GHOSTJ.C. MELLENCAMP PAPERRICHARD MARX SHOULDPATTY SMYTH ISN'TWHITESNAKE HEREWHITESNAKE ISMEDIUM38 SPECIALBEAT FARMERSBOSTON(BRYAN ADAMSJON BUTCHERTHE CULTEUROPEGRATEFUL DEADGRATEFUL DEADHEARTJON ASTLEYLOVERBOYMASON RUFFNEROMAR/HOWLERSTOM PETTYPAUL KELLYROGER WATERSTHE SILENCERSTESLAURGENTLIGHTDEF LEPPARD ANIMALDEF LEPPARD HYSTERIASAMMY HAGAR EAGLESSAMMY HAGAR GIVELITTLE AMERICA WAYLOST BOYS ST GOODLOST BOYS ST SHADOWSMOTLEY CRUE WILDJOHN WAITE TIMES

BACKDARKHOLLYANNVICTIMWISHESWILDCARRIEHELLTOUCHWHOJANENOTORIOUSWORLDDANCINGMIXEDDARLINGSUNSETPAINTEDROCKTAKE

CHART KEY* = Top 5 Requests

= Increased Rotation(CD) = CD Airplay

(CD)

(CD)

(CD)

(CD)

03

CD

(CD)

KEYX PHOENIXM.D. JONATHAN ROSENPH: 602-964-3100MUSIC:MON AFTCALLS:TUE-WED 2- 4

MEDIUM ADDSTHE BRANDOSTHE CARSDB.SECHO/BUNNYMENLIGHT DDS10,000 MANIACS LPTOM VERLAINE CRY

HEAVYBEAT FARMERSTHE CURETHE CURETHE CURE(DON DIXONDEAD MILKMENECHO/BUNNYMENECHO/BUNNYMENTHE FIXXICICLE WORKSNEW ORDERPET SHOP BOYSPAUL KELLYREPLACEMENTS

(THE SAINTSTHE SILENCERSTONIO KPETE WYLIE

MEDIUM10,000 MANIACS TALKNEW MODEL ARMY WHITEANDY SUMMERS LPDAVID BOWIE NEVERBRIAN BRAIN LPCROWDED HOUSE WALKCRUZADOS YOUNGDEPECHE MODE STRANGETHRASHING DOVES RIBAJOE ELY BABYERASURE VICTIMHURRAH LPSTEVE JONES DRUGSLIVING/DAY ST WHEREMIGHTY LEMON DR LP

JESSICA

GETTYSBURGUETTYSBURG

LPLIPS

LIME SPIDERSNEIGHBORHOODSPLASTICLAND LPPUSHTWANGERS EPREDD KROSS LOVEREPLACEMENTS HARDLYROBERT VAUGHN LPTHE SMITHS SWEETUB40 CHERRYWIRE TRAIN DIVINGX LPLIGHTDADDY IN/SLEEP BLUEENDMEN COULDFACTORY COMPIL. LPKINETICS LPLUCKY 7 LPMOOD SIX LPHARD ONS GIRLPETER/BABIES KEYRIVER ROSES PHOENIXSWIMMING/Q'S EPTHRILL OF THE.. LPTHAT PETROL EMO SPINURBAN BLIGHT LPWEDNESDAY WEEK WHYWILD FLOWERS KINGDOMWILD FLOWERS LP

KEgE4POSANEp.u. (*Amy ALLENM.D. CURT CARTIERPH: 509-448-1000MUSIC:TUE AFTCALLS:THU-FRI 10-12

HEAVY ADDSAEROSMITH

MEDIUM ADDSHEARTPETE HARDENSSTEPPENWOLFLIGHT ADDSHOOTERSWHITESNAKE

HEAVY*JON BUTCHER WISHESCHARLIE DANIELS BOGGEDCRUZADOS BED

*DEF LEPPARD WOMEN*STEVE EARLE SATISFIED (CD)*GREAT WHITE ROCK*SAMMY HAGAR EAGLES}HOOTERS SATELLITE(INSIDERS GHOSTJ.C. MELLENCAMP PAPER (CD)ROGER WATERS WHOJOE WALSH CARMEDIUMBEAT FARMERS DARKBOSTON STILL (CD)THE BRANDOS GETTYSBURGTHE CULT WILD(DIO DREAMERFABULOUS THIRDS SPELLFLEETWOOD MAC SEVENGLEN BURTNICK FOLLOWGRATEFUL DEAD HELLSAMMY HAGAR BOYSLITTLE AMERICA WAYLOST BOYS ST GOOD

NOTORIOUSWHEREINCOMMUN

SHOULD

MANLONELYMIXEDDARLINGPAINTEDROCKDANCEWEAPONS (CD)HOTTAKETOUCHDETOX

DARKBEAUTIFUL (CD)HEAVENHOTHEART

GAMEINSTANTNEWSCAREDJANEFAITH

LPSIN

ALEXTEMPLE

PAINTEDSINFUL

(CD)

LIVING/DAY STMARILLIONRICHARD MARXMASON RUFFNERNEIL YOUNGOMAR/HOWLERSTOM PETTYPAUL KELLYTHE SILENCERSTESLATOM KIMMELTHE TRUTH_TWISTED SISTER(URGENTJOHN WAITEWARREN ZEVON

LIGHTBRYAN ADAMSDEF LEPPARDGUNS N' ROSESMOTLEY CRUEMELVIN JAMES.REFUGTNT

EE

PRINCES TRUST

KEZO OMAHAP.D. BILL BRUUNM.D. JOE BLOODPH: 402-592-5300CON: B-A-D-EMUSIC:MON MORCALLS:WED-FRI

HEAVY ADDSTHE CARS

MEDIUM ADDSAEROSMITHCUTTING CREW

HEAVYLA BAMBA STDEF LEPPARD(GREAT WHITE

DUDE

TOUGHDREAMSGIVE

HARDGIVE

VICTIMTEARWELCOMEWILD (CD)WHYSURVIVAL (CD)STARMONEY (CD)

2- 3

YOU

DUDELOVE

BAMBAANIMAL

WHOROCK

(HOOTERS JOHNNYJ.C. MELLENCAMP PAPERJON ASTLEY JANELOST BOYS ET GOODOUTFIELDMEDIUMTHE BEARSBEAT FARMERSTHE CALL

SINCE

FEARDARKWANNAWILD

DEF LEPPARD GODSDEF LEPPARD LOVEDIO DREFABULOUS THIRDS SPELLERGRATEFUL DEAD HELL

03

(CD)

/S131

&131(CD)

Sig3

(CD

August 21 1987

GRATEFUL DEADSAMMY HAGARINSIDERSLITTLE AMERICALOVERBOYLIVING/DAY STRICHARD MARXMELVIN JAMESMR. MISTEROMAR/HOWLERSTOM PETTYPAUL KELLYROGER WATERSTHE SILENCERSSTEPPENWOLFSUZANNE VEGAU2JOE WALSHWARREN ZEVON

WESTHOMEGHOSTWAYNOTORIOUSWHERESHOULDWHYSOMETHINGMANMIXEDDARLINGSUNSETPAINTEDHOLDSOLITUDESPANISHCARDETOX

KFMF CHICOP.D. RON WOODWARDM.D. MARTY GRIFFINPH: 916-343-8461CON: B -A -D -EMUSIC:TUE AFTCALLS:WED-FRI 10-12

(CD)

(CD)

(CD)

CD'CDCDCDCDCD

(CD)

MEDIUM ADDSAEROSMITH DUDE (CD)THE CARS YOUCUTTING CREW LOVELIGHT ADDSULTRAVIOLET HOME

HEAVY38 SPECIAL BACKBEAT FARMERS DARKCHARLIE DANIELS BOGGEDCRUZADOS BED (CD)*DEF LEPPARD WOMEN(GRATEFUL DEAD HELLGREAT WHITE ROCK (CD)HOOTERS JOHNNY!INSIDERS GHOSTJ.C. MELLENCAMP PAPER (CD)LOST BOYS ST GOOD

(LIVING/DAY ST WHERETOM PETTY MIXED (CD)(ROGER WATERS SUNSETJOHN WAITE TIMESJOE WALSH CAR

*WHITESNAKE HERE (CD)MEDIUMBACK/BEACH ST PIPELINEDAVID BOWIE NEVER CD)BRYAN ADAMS VICTIMJON BUTCHER WISHESTHE CALL WANNA CDDEF LEPPARD ANIMALDIO DREAMER (CD)FABULOUS THIRDS SPELL (CD)GLEN BURTNICK FOLLOWGRATEFUL DEAD TOUCH (CD)SAMMY HAGAR BOYSSAMMY HAGAR HOME*JON ASTLEY JANE (CD)LOVERBOY NOTORIOUSRICHARD MARX SHOULDMASON RUFFNER WORLD iSS3MELVIN JAMES WHYMR. MISTER SOMETHING CDOMAR/HOWLERS DANCING CDPETE BARDENS DREAMS CDPAUL KELLY DARLING CDGREGG ROLIE HANDSROBERT VAUGHN JUSTICETHE SILENCERS PAINTEDPATTY SMYTH ISN'T (CD)STARSHIP BABYLON (CD)STEPPENWOLF HOLDU2 STREETS (CD)WARREN ZEVON DETOX (CD)LIGHTLA BAMBA ST BAMBA

KFMG ALBUQUERQUEP.D. KARL BAEHRM.D. MICHAEL DAVISPH: 505-265-8811CON: JEFF POLLACK

POWER ADDSTHE CARS

HEAVY ADDS*AEROSMITHHEARTWHITESNAKE

MEDIUM ADDSFABULOUS THIRDS

LIGHT ADDSTHE CULTMELVIN JAMESTNT

POWER*J.C. MELLENCAMPTOM PETTY

HEAVY38 SPECIALLA BAMBA STCRUZADOSDEF LEPPARDEUROPEGRATEFUL DEAD*GREAT WHITESAMMY HAGARJON ASTLEYLIVING/DAY STMR. MISTERROGER WATERS

MEDIUMACE FREHLEYBEAT FARMERSBRIAN MCDONALDDAVID BOWIEBRYAN ADAMSCROWDED HOUSEDEF LEPPARDDIOINSIDERSLOVERBOYMASON RUFFNERTHE SILENCERSSTEPPENWOLFTESLAURGENTJOE WALSHLIGHTFASTER puss*CATGLEN BURTNICKHELIXPAUL KELLY

YOU

DUDEWAIT 03IS (CD)

SPELL (CD)

WILD (CD)WHYSTAR (CD)

PAPER (CD)MIXEDSTREETS (CD)

BACKBAMBA (CD)BEDWOMENCARRIEHELLROCKHOMEJANEWHERESOMETHING (CD)SUNSET

ROCKDARKLIFENEVER (CD)VICTIMWORLDROCKETDREAMERGHOSTNOTORIOUSWORLDPAINTEDHOLDROCKTAKECAR

(CD)

CHANGEFOLLOWWILDDARLING

KFMQ LINCOLNP.D. BOB ALLENM.D. JOE SKAREPH: 402-489-6500CON: AL PETERSONCALLS:WED-THU 11- 1

03

HEAVY ADDS

THEAEROSMITCARSH DUDE

LIGHT ADDSYOU

JOHN HIATT THINGY&T TEMPTATION

POWERDOS

*DEFCRUZA LEPPARD WOMENBED (CD)

HOOTERS JOHNNYJ.C. MELLENCAMP PAPER

BRYAN ADAMS VICTIM

(CD)HEAVY

*JON BUTCHER WISHES 03DEF LEPPARD ANIMALDEF LEPPARD HYSTERIAFABULOUS THIRDS SPELL (CD)GRATEFUL DEAD HELL*GRATEFUL DEAD WEST*GREAT WHITE ROCK 01SAMMY HAGAR BOYSSAMMY HAGAR HOME (CD)HOOTERS SATELLITEINSIDERS GHOST CRICHARD MARX SHOULD CDTOM PPOCVRETTYwATERS SUNSET CD

MIXED CD

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (42)

THEHARD REPORT REPORTS

CONTINUEDPATTY SMYTHJOE WALSH CAR

MEDIUMBEAT FARMERSLOVERBOYtMELVIN JAMESMR. MISTERNEIL YOUNGSTARSHIPSTEPPENWOLFSUZANNE VEGAWHITESNAKELIGHTEUROPEGLEN BURTNICKPAUL KELLYREPLACEMENTSTWISTED SISTERURGENTWARREN ZEVON

ISN'Trai

DARKNOTORIOUSWHYSOMETHINGLONELYBABYLONHOLDSOLITUDE (CD)IS

CARRIE (CD)FOLLOWDARLINGALEXHOTTAKEDETOX (CD)

KFMU STEAMBOATNAILP.D. KELLY THOMASM.D. DAVE ROSSPH: 303-879-5368MUSIC:MON AFTCALLS:MON-TUE 12- 3FROZEN REPORT

HEAVY38 SPECIAL BACKLA SAMBA ST BAMBATHE CALL WANNACRUZADOS BED 1SB3FABULOUS THIRDS SPELLGRATEFUL DEAD TOUCH

(CD)HT WHOHOOTERS JOHNNYJON ASTLEY JANELOST BOYS ST GOOD

1P1TOM PETTY MIXEDTHE SILENCERS PAINTED CDSTARSHIP BABYLON

MEDIUMTHE BEARS FEAR (CD)BEAT FARMERS DARKDAVID BOWIE NEVERCHARLIE DANIELS BOGGEDCRUZADOS LASTCRUZADOS SUMMERS (CD)ROGER DALTREY FIREFABULOUS THIRDS STANDFIGURES/BEACH STARS CDTHE FI SCAREDCDGRATEFUL DEAD HELL CDGRATEFUL DEAD WEST CDJ.C. MELLENCAMP PAPER CDLIVING/DAY ST WHEREMR. MISTER SOMETHING CD)OUTFIELD SINCEROGER WATERS SUNSET CD)ROBERT VAUGHN JUSTICETOM KIMMEL FREEDOM

(CD)JOHN WAITE TIMESLIGHT10,000 MANIACS PEACETHE BRANDOS GETTYSBURGBRYAN ADAMS HEARTS (CD)CUTTING CREW LOVECROWDED HOUSE SOMETHING (CD)THE CURE HEAVEN (CD)DB'SDAVE PERKINS TURNFARRENHEIT BADGLEN BURTNICK FOLLOW (CD)INSIDERS GHOSTLIVING IN A BOX LIVINGMARILLION INCOMMUN CDRICHARD MARX MEANM. TOMLINSON BELIEVENEIL YOUNG LONGGARY HUMAN RADIOSIMPLE MINDS MIRACLE iggiSTARSHIP OVERTOM KIMMEL DANCEWHAT IF WHAT (CD)PETE WYLIE SINFULWARREN ZEVON MONKEY (CD)

KFMX-FM LUBBOCKP.D. GARY WINTERM.D. LORIS LANEPH: 806-747-1224MUSIC:TUE AFTCALLS:THU 12- 3

HEAVY ADDSAEROSMITHTHE CARS

MEDIUM ADDSACE FREHLEYTHE CULTINSIDERSMOTLEY CRUETHE SILENCERS

POWER38 SPECIAL BACKILA SAMBA ST BAMBACRUZADOS BEDJOE ELY LORD,GRATEFUL DEAD TOUCH?GREAT WHITE ROCKHEARTHOOTERS JOHNNYJ.C. MELLENCAMP PAPER*WHITESNAKE HEREHEAVY!JON BUTCHERDEF LEPPARDFLEETWOOD MACGRATEFUL DEADSAMMY HAGAR*JON ASTLEYLOST BOYS STLOVERBOYOUTFIELDTOM PETTYMEDIUMBEAT FARMERSBRYAN ADAMSTHE CALLCHARLIE DANIELS*DIOEUROPEFABULOUS THIRDSSAMMY HAGARRICHARD MARXRICHARD MARXMR. MISTERPAUL KELLYROGER WATERSPATTY SMYTH

STARSHIPUU2JOHN WAITEJOE WALSH

WISHESWOMENMIDNIGHTHELLBOYSJANEGOODNOTORIOUSSINCEMIXED

YOUDUDE

(CD)

ROCK

PAINTEDrilCD

GHOST

CDCDCDCDCDCDCD

(CD)

CDCD

CD

DARKVICTIM (CD)WANNABOGGEDDREAMERCARRIE

MEANGIVE CD

CD

STAND

SHOULDSOMETHING (CD)DARLING (

SUNSETISN'T (CD)OVERSPANISH

TIMESSTREETS pi

CD)CAR

KFOG SAN FRANCISCOP.D. DAVE LOGAN/OMM.D. SKY DANIELSPH: 415-986-1045

HEAWfADDSSQUEEZE

MEM UM ADDSHOUR

MASON RUFFNER RED

HEAVYBEAT FARMERS DARKDAVID BOWIE NEVERTHE CALL WANNACUTTING CREW LOVECRUZADOS BEDSTEVE EARLE SATISFIEDFABULOUS THIRDS SOFA*FABULOUS THIRDS SPELLFLEETWOOC LITTLE*GRATEFULD DMEAAD LPJOHN HIATT ALONEJOHN HIATT THANKJOHN HIATT THINGHOOTERS JOHNNYINSIDERS GHOST*J.C. MELLENCAMP PAPER

LIVING/DAY ST WHEREMASON RUFFNER WORLDMARC JORDAN INDEPENDENTOM PETTY MIXED*PAT METHENY LASTROGER WATERS RADIOROGER WATERS SUNSETROGER WATERS TIDEROGER WATERS WHOGREGG ROLIE HANDSRON THOMPSON GAMBLESTARSHIP BABYLONU2 BULLET,U2 COUNTRYU2 REDU2 SPANISHU2 STREETSU2 TRIP

MEDIUMLA BAMBA ST BAMBATHE BEARS FEARDAVID BOWIE BANGDAVID BOWIE GLASSDAVID BOWIE TIMETHE BRANDOS GETTYSBURGCHARLIE DANIELS BOGGED*co*ck ROBIN JUSTCROWDED HOUSE WORLDROGER DALTREY FIREECHO/BUNNYMEN ALLELTON JOHN CANDLEFLEETWOOD MAC SEVENFLEETWOOD MAC TANGOSAMMY HAGAR GIVEBONNIE HAYES SOMEHOOTERS SATELLITEJON ASTLEY JANELOST BOYS ST GOODMARILLION INCOMMUNMELVIN JAMES WHYALISON MOYET WRONGOMAR/HOWLERS GRINDOMAR/HOWLERS MANOMAR/HOWLERS SHADOWPATRICK O'HEARN OPTIMISTIC

Bg FM SAN. DIE ?3.u. UWARD

M.D. PAM EDWARDSPH: 619-292-1360

HEAVY ADDSTHE CARS YOUMEDIUM ADDSAEROSMITH DUDEBILLY IDOL MONYBRYAN ADAMS VICTIMFABULOUS THIRDS SPELLHEART WAITMOTLEY CRUE WILDMR. MISTER SOMETHING

LauAl,aSTLERS MAN

MELVIN JAMES WHY

POWERBEAT FARMERS DARKSAMMY HAGAR GIVE

J.C.WHO

.CA. MELLENCAMP PAPERLOST BOYS ST GOODRICHARD MARX MEANU2 SPANISHWHITESNAKE HEREHEAVYJON BUTCHER WISHESCRUZADOS BEDDEF LEPPARD WOMENFLEETWOOD MAC MIDNIGHTGRATEFUL DEAD TOUCHISAMMY HAGAR HOMEHOOTERS JOHNNYJON ASTLEY JANEtLIVING/DAY ST WHEREOMAR/HtIWLERS HARDOUTFIELD SINCETOM PETTY MIXEDWHITESNAKE ISMEDIUMBACK/BEACH STBEAT FARMERSDAVID BOWIETHE CULTDEF LEPPARD

EUROPEGLEN BURTNICKGRATEFUL DEADGREAT WHITEHOOTERSINSIDERSLOVERBOYRICHARD MARXMASON RUFFNERTHE PALADINSPETE HARDENSPRIVATE DOMAIN/REPLACEMENTSROGER WATERSROBERT VAUGHNTHE SILENCERSPATTY SMYTHTESLATOM KIMMELURGENTJOE WALSH?WARREN ZEVONLIGHTTHE CALLCHARLIE DANIELSCROWDED HOUSESTEVE EARLEHEARTNEIL YOUNGREFUGEETWISTED SISTER

CDCD',

CDCDCD

(CD)

(CD)

iC1CD

(CD)

(CD)

PIPELINEHOLLYWOOD (CD)NEVERWILDANIMALDREAMERCARRIEFOLLOWHELL (CD)R (CD)SATELLITEGHOST

NOTORIOUSSHOULDWORLDHOLDDREAMSSALEX (CDSUNSET (CD)JUSTICEPAINTED

RONTFREEDOM CD

CD

TAKECARDETOX (CD)

(CD)

(CD)

(CD)

WANNABOGGEDWORLDSATISFIED

PRISONERS

SURVIVAL

KGRO CASPERP.D. FRED LEEMHUISPH: 307-266-1400MUSIC:TUE MORCALLS:MON-FRI 2-40

HEAVY ADDSTHE CARS YOUMEDIUM ADDSD.L. JONES BONNIEBONNIE HAYES SOMEMARILLION SUGAR (CD)LIGHT ADDSTHE BRANDOS GETTYSBURGMELVIN JAMES WHYTOM KIMMEL DANCE

POWER

GOCURWESTIOSITY/CAT MISFIT

/HEART GIRL [219i

TOMLIVINGPETTY

MIXED/DAYST WHERE

SWING/SISTER BREAKOUT 12g3HEAVYICRUZADOS WORLDFLEETWOOD MAC MIDNIGHT Erl),

RICHARD MARX SHOULD (CD)*M. TOMLINSON BELIEVEM. TOMLINSON DREAMIPAUL KELLY BEFORE (CD)PAUL KING KNOWWETTON/MANZARA JUSTMEDIUM10,000 MANIACS JACK (CD)

*LA BAMBA ST BAMBATHE CALL WANNA (CD)CHARLIE DANIELS BOGGEDco*ck ROBIN JUST CDCROWDED HOUSE WORLD CDCHRIS DEBURGH FATAL CDJOE ELY LORD CDFABULOUS THIRDS SPELL CDFABULOUS THIRDS STAND CDJOHN FARNHAM PRESSURE CDMICHAEL FRANKS SAXGRATEFUL DEAD PUSH CD*GREAT WHITE ROCK CDINSIDERS GHOSTICICLE WORKS SWEET CD

*J.C. MELLENCAMP PAPER CDJESSE C. YOUNG ERICAMR. MISTER SOMETHING (CDN. TREMULIS MOREPETE HARDENS DREAMS CDPAUL JANZ CRY CDROGER WATERS TIDE CDGREGG ROLIE HANDSTHE SILENCERS PAINTED (CD)

PATTY SMYTHSUZANNE VEGAPETE WYLIEWARREN ZEVONLIGHTCRUZADOSSTEVE EARLEFIGURES BEACHTHE FIXXDAN FOGELBERGDAN FOGELBERGHEARTHOOTERSJON ASTLEYLOVERBOYRICHARD MARXMASON RUFFNEROMAR/HOWLERSPAT METHENYSTAN CAMPBELLSTEPPENWOLFWENDY WALDMAN

SOLITUDE (CD)SINFULHEARTACHE

BED

TARSSATISFIED

(CD)

SSCARED SB3LONELYMATTER

iSBIWHOJOHNNYJANENOTORIOUSHEAVENWORLD SEiiDANCINGLASTNE R

PEIHOVDNG

CD

KICT WICHITAP.D. ERIC TAYLORM.D. PHIL THOMPSON,,PH: 316-722-5600CON: B -A -D -E

HEAVY ADDS*AEROSMITH.MEDIUM ADDSTHE CARSLIGHT ADDSTOM KIMMEL

HEAVY*DEF LEPPARD EXCITABLEGRATEFUL DEAD TOUCH

/GREAT WHITE ROCKHOOTERS JOHNNYJ.C. MELLENCAMP PAPERJON ASTLEY JANE?MELVIN JAMES WHYOUTFIELD SINCEITOM PETTY MIXEDU2 STREETSWHITESNAKE HERE

MEDIUMAUTOGRAPH DANCETHE BEARS FEARBEAT FARMERS DARKCUTTING CREW LOVECHARLIE DANIELS BOGGEDCRUZADOS BEDDEF. LEPPARD ANIMALDEF LEPPARD HYSTERIADEF LEPPARD WOMENDIO RDEAME*EUROPE CARRIERFABULOUS THIRDS SPELLFLEETWOOD MAC MIDNIGHTGRATEFUL DEAD HELLGRATEFUL DEAD WESTSAMMY HAGAR BOYSSAMMY HAGAR HOMEINSIDERS GHOSTLOVERBOY NOTORIOUSLIVING/DAY ST WHERERICHARD MARX SHOULDOMAR/HOWLERS MANPETE BARDENS DREAMS*PAUL KELLY DARLINGREPLACEMENTS ALEXROGER WATERS SUNSETSTEPPENWOLF HOLDSUZANNE VEGA SOLITUDELIGHTJON BUTCHER WISHESROGER DALTREY FIREFIRE TOWN RAINDEL FUEGOS NAMEHEGE V HOUSENEIL YOUNG LONELYTNT LOVWORLD PARTY ALL

DUDE

YOU

DANCE

KILO COLO. SPRINGSP.D. RICH HAWKM.D. ALAN WHITEPH: 303-634-4896CON: LARRY BRUCEMUSIC:TUE MORCALLS:WED-FRI 9- 5

HEAVY ADDSTHE CARS YOU

MEDIUM ADDSAEROSMITH DUDEDEF LEPPARD HYSTERIA

LIGHT ADDSYET

HLLA SAMBA ST BAMBACRUZADOS BEDDEF LEPPARD ANIMAL

*DEF LEPPARD WOMENGRATEFUL DEAD HELL*GREAT WHITE ROCKISAMMY HAGAR HOMEHOOTERS JOHNNYJ.C. MELLENCAMP PAPER?JON ASTLEY JANELOST BOYS ST GOOD

ILOVERBOY NOTORIOUSJOE WALSH CARWHITESNAKE HEREMEDIUM38 SPECIAL RACKBACK/BEACH ST PIPELINEBEAT. FARMERS DARKDAVID BOWIE NEVERBRYAN ADAMS VICTIMJON BUTCHER WISHESCHARLIE DANIELS BOGGED

EUROPEDREAMER

FABULOUS THIRDS SPELLFLEETWOOD MAC LITTLEGLEN BURTNICK FOLLOWGRATEFUL DEAD TOUCHGRATEFUL DEAD WESTSAMMY HAGAR BOYSHEART GIRLHEART WAITHOOTERS SATELLITEINSIDERS GHOSTLIVING/DAY ST WHERERICHARD MARX SHOULDMASON RUFFNER WORLDMOTLEY CRUE WILDMELVIN JAMES WHYMR. MISTER SOMETHINGNEIL YOUNG LONELYOUTFIELD AMERICAOUTFIELD HEARTTOM PETTY MIXEDPAUL KELLY DARLINGREPLACEMENTS ALEXROGER WATERS SUNSETTHE SILENCERS PAINTEDPATTY SMYTH NEVERSTARSHIP

. BABYLONSTEPPENWOLF HOLDURGENT TAKEWHITESNAKE ISWARREN ZEVON DETOXLIGHTTHE BRANDOS GETTYSBURGFASTER puss*CAT CHANGEGUNTARGUNS N. ROSES WELCOME

KINK. PORTLANDP.D. CARL WIDINGM.D. KERI STONEPH: (503) 226-5080

MEDIUM ADDSTHE CARS YOUWHAT IFVIENNARICHIE HAVENS

(CD)

(CD)

(CD)

(CD)

TEMPTATION (CD)

(CD)

pCDl

(CD)

(CD)

(CD)

(CD)

CDCDCD

CD

i83

(CD)

((CD)

(CD

HEAVYSWING OUT SISTERG. WASHINGTONR. MARXPAT METHENYR. CASHCROWDED HOUSELEVEL 42RAMSEY LEWISFLEETWOOD MACCOLIN HAY"OVER THE TOP"P. O'HEARNDAVE SANBORNHERB ALPERTHEARTJ. JARVISLARRY CARLTONDAN FOGELBERGDAVID BENOITYELLOWJACKETSGLORIA ESTEVEZBENSON i KLUGH"SECRET/SUCCESS"PETE HARDENSGRATEFUL DEADMEDIUM"LIVING DAYLIGHT"DANNY WILSONBIRDS OF A FEATHERELTON JOHNJUDE COLETHE CITYANDY SUMMERSMICHAEL FRANKSNEIL YOUNG

KISS SAN ANTONIOP.D. JIM CHRISTOPHERM.D. TOM SCHEPPKE/APPH: 512-223-6211MUSIC:TUE AFTCALLS:MON 3- 5

POWER ADDSAEROSMITH DUDEHEAVY ADDSTHE CARS YOU

MEDIUM ADDSKEEL SAID

LIGHT ADDSSCREAM

BRIAN'MCDONALD LIFEMELVIN JAMES WHYSTEPPENWOLF GIVE

POWERDEF LEPPARD WOMEN

*GREAT WHITESAMMY HAGAR

ROCK CDCD

J.C. MELLENCAMP PAPERHEAVYBRYAN ADAMS

THE CULT ::::(CD)

IMBEDCRUZADOS

*DEF LEPPARDDEF LEPPARD

ANIMAL

DIO DRFABULOUS THIRDS STANDGRATEFUL DEAD TOUCHD (CD)H

IOVERBOYJOHNNY

(PATTY SMYTHNOTORIOUS

*TWISTED SISTER HOTJOE WALSH CARWHITESNAKE IS

MEDIUMBEAT FARMERS DARKFABULOUS THIRDS SPELLFASTER puss*CAT CHANGEGRATEFUL DEAD HELL (CD)*GUN MASONROSES WELCOME (CD)

RUFFNER WORLDMOTLEY CRUE NAMEPRETTY MAIDS LOVEPOISON FORGETROGER WATERSSUNSET (CD)ROGERURGENT TAKE*YET TEMPTATIONLIGHTJON BUTCHER WISHES (CD)JOE ELYEZO AIRENEIL YOUNG LONELYSHY EMERGENCY

MSWSEATTLEP.D. JON ROBBINSM.D. MIKE JONESPH: 206-285-7625

FROZEN REPORT

HEAVYBEAT FARMERS DARKGREAT WHITE ROCK

J.C.WHO

MELLENCAMP PAPERLOST BOYS ST GOODOMAR/HOWLERS HARDU2JOHN WAITE TOUCHMEDIUMLA SAMBA STBACK/BEACH STDAVID BOWIECRUZADOSCRUZADOSDEF LEPPARDDEF LEPPARDDEF LEPPARDGRATEFUL DEADGRATEFUL DEADGRATEFUL DEADGREGG ALLMANSAMMY HAGARHOOTERSHOOTERSINSIDERSLITTLE AMERICALOVERBOYLIVING/DAY STMASON RUFFNEROMAR/HOWLERSOUTFIELDROGER WATERSU2PATTY SMYTH

JOE WALSHWHITESNAKE

KJET SEATTLE

BAMBAPIPELINENEVERLASTSUMMERS

TEARANIMAL

WOMENHELLTOUCHWEST

BOYSCROSS

JOHNNYSATELLITEGHOSTYOU

WHEREWORLDLEEAMERICAWISN'TTRIPCARHERE

P.D. JIM KELLERPH: 206-281-5600MUSIC:TUE MORCALLS:TUE-THU

(CD)

(CD)

HEAVY ADDSDUKE/STRATOSPHR LPMEDIUM ADDSTHM PCRUCK NOWHEREERELIGHT ADDSBACK/BEACH ST LPTHE BRANDOS GETTYSBURGLIME SPIDERS LPNEIGHBORHOODS PURE

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (43)

THE REPORTSCONTINUED

HEAVY10,000 MANIACS PEACEBEAT FARMERS DARKTHE CALL WANNATHE CURE WHYECHO/BUNNYMEN NEW

tGO-BETWEENS LPHURRAH LPNEW ORDER FAITHPRIVATE DOMAIN LPREPLACEMENTS LPTHE SILENCERS LPSUZANNE VEGA LPTHAT PETROL EMO LPU2 LPU2 SPANISHX LPWARREN ZEVON LPMEDIUMLONELY EYESORE LPNEW MODEL ARMY LPLA SAMBA ST BAMBADAVID BOWIE NEVERco*ck ROBIN JUST

IDSCRU'S

LPZADOS

BED

DEPECHE MODE STRANGEFACTORY COMPIL. LPFIGURES/BEACH STARSY. FRESH FELLOW LPFIRE TOWN LPHOODOO GURUS OUTJOHN HIATT THANKICICLE WORKS JANEJULIAN COPE LPJESUS/MARY CH APRILLIVING/DAY ST WHEREMIGHTY LEMON DR OUT

7 LP,MOJO NIX EMOODLUCKY SIXON LPLVISPAUL KELLY DARLINGREM LPROYAL C. MOB LPSTAN CAMPBELL YEARSTIREZ TIREZ LPTONIO K SEXTOM VERLAINE LPUB4BA0 LPURN BLIGHT LP

WEIN NDY &VITRO

LISA LPLP

PETE WYLIE SINFULLIGHTTHE LPBLEACHEDBEARS BLACK LPBOB PFEIFER SUCCESSBRIAN BRAIN LPDURAN DURAN LIVEJOE ELY LPFRENCH/FRITH... LPLIONS & GHOSTS MARYTHE LONG RYDERS I

OT Wigupoit STONE

PH: 208-344-3511CON: BEAU PHILLIPSMUSIC:MON MORCALLS:MON 10-12

HEAVY ADDSAEROSMITH DUDETHE CARS YOU

MEDIUM ADDSMR. MISTER SOMETHINGSTEPPENWOLF GIVE

HEAVYCRUZADOS BEDDEF LEPPARD ANIMAL*DEF LEPPARD WOMEN*GRATEFUL DEAD TOUCH*GREAT WHITE ROCKHOOTERS JOHNNYJ.C. MELLENCAMP PAPERU2*WHITESNAKE HEREMEDIUMLA BAMBA ST BAMBABEAT FARMERS DARKBRYAN ADAMS HEARTSBRYAN ADAMS VICTIMTHE CULT WILDSTEVE EARLE SATISFIEDEUROPE CARRIEFABULOUS TBIRDS SPELLGRATEFUL DEAD HELLSAMMY HAGAR BOYSHEART TOUGHHEART WHOHOOTERS SATELLITEINSIDERS GHOSTLOST BOYS ST GOODLOVERBOY NOTORIOUSMASON RUFFNER WORLDOMAR/HOWLERS LEEPETE BARDENS DREAMSTOM PETTY MIXEDTHE SILENCERS PAINTEDPATTY SMYTH ISN'TTHE TRUTH WEAPONSJOE WALSH CARWARREN ZEVON DETOXLIGHTDIO DREAMERGUNS N' ROSES WELCOME*MANOWAR DEFENDERMOTLEY CRUE WILDOMAR/HOWLERS HARDURGENT TAKE

KKCY. SAN FRANCISCOP.D. KATE HAYESM.D. LORRAINE MEIERPH: 415-442-1800

MEDIUM ADDS10,000 MANIACSGRATEFUL DEADCARS

LIGHT ADDSALCHEMYBEAT FARMERSW. ORBITDAVE MASONLYNCH MOBMARILLION

TALK/JACKTHROWINGYOU

MR/RIDE.MAKE/ROSYSWAMPLOVESATISFIEDSUGAR

HEAVYFAB. T -BIRDSMARSHALL CRENSHAWJ. C. MELLENCAMPGRATEFUL DEADLOS LOBOSBRUCE co*ckBURNFAB. T -BIRDSMICHAEL FRANKSPAT METHENYNONA HENDRIXCHRIS ISAAKTOM PETTYCRUZADOSMARSHALL CRENSHAWLARRY CARLTON. ESISTORSGR.TEFUL DEAD10,000 MANIACSco*ck ROBINMEDIUMPRETENDERSDOUG HAMBLINJOAN BAEZCROWDED HOUSEGRATEFUL DEADWARREN ZEVON

STEVE GOODMANJOHN JARVIS

(CD)

CD

CDCD

CDCDCDCD

(CD)

SPELLMARYJEANPAPERPUSHLA BAMBA/CHARLENPWAITING/STOLENSTANDDOCTOR/ISLELASTFEMALE/WINDSBLUE/WILDMIXEDWORLD/TIMEEASYMARCHSHAKE/GAMBLEHELLPEACEJUST

WHERELPLPWORLDWESTFACTORY/MONKEY/RECONSIDERLPSOUTHERN/WIDE

U2DAN FOGELBERGJ. SIEGELJOE WALSHJOHN HIATT

FAB. T -BIRDSSWING OUT SISTERPAUL KELLYSTARSHIPBACK/BEACH STLOST BOYS STECHO/BUNNYMENPETE BARDENSSILENCERSREPLACE

SCHON, WERZ/SCOTT

JOE ELYTHIRD WORLDLYLE LOVETT

BONNIE HAYESLIGHTELEANORWONDERWALLTIREZ TIREZ

FARRENHEITFIRE TOWNMOOD SIXBUCKWHEAT ZYDECO

PRIVATE DOMAINGO WESTOPERATION BIGJOE ELYDUANE EDDY

TIMES/STREETSWHATTROUBLECAR/MEMORY/TIMESTOOD/THING/MEMPHISMAN/TEARSBREAKTRAIN/STONEWHERELPPEOPLEGAMEDREAMS/SEASCAPEBLUE/GOD'SNIGHTCLUB/SKYWAYCAIRO/WISHINGROWGET/SIMPLICITYPORCH/KNOW

SOME

BETTER/SAYPERFECTSOMEBODY/SPIN/WAKEIMPOSSIBLERAINLIGHTMARIE/NIGHT/HONLAYLPLITTLE/KINGLET/LOVERLORDBLUE/TREMBLE/SOMETHING

KLAQ EL PASOP.D. NAT LAMPM.D. MIKE RAMSEYPH: 915-544-8864CON: JON SINTONMUSIC:TUE MORCALLS:FRI-MON 9-10

MEDIUM ADDSAEROSMITH DUDEDAVID BOWIE NEVERTHE CARS YOUTHE CULT WILDDISORDERLIES ST EDGEFABULOUS TBIRDS SPELLINSIDERS GHOST

POWER38 SPECIAL BACKLA BAMBA ST

!BAMBA

BRYAN ADAMS VICTIM (CD)JDEF LEPPARD WOMEN?EUROPE CARRIESAMMY

WHHAGAR GIVE

HEARTSTARSHIP OVER

*WHITESNAKE HEREHEAVYCRUZADOStDEF LEPPARDFLEETWOOD MACGRATEFUL DEAD*GREAT WHITE ROCK (CD)HOOTERS JOHNNY

U2RICHARD MARX SHOULDLOVERBOY NOTORIOUS CD

STREETS CD

CD

CD

J.C. MELLENCAMP PAPER

MEDIUMACE FREHLEY ROCKBEAT FARMERS DARKCROWDED HOUSEDIO DREAMERDANNY WILSON PRAYERFASTER puss*CAT CHANGEGRATEFUL DEAD HELLGUNS N' ROSES WELCOMESAMMY HAGAR BOYSJON ASTLEYMR. MISTERPETE BARDENSTOM PETTY*PAUL KELLYROGER WATERSPATTY SMYTHSUZANNE VEGATESLAURGENTJOE WALSHY&T

U2JOE WALSHtWHITESNAKEWARREN ZEVON

MEDIUMBEAT FARMERSBON JOVIGRATEFUL DEADSAMMY HAGARSAMMY HAGARIMARILLIONMASON RUFFNERtOMAR/HOWLERSOUTFIELD*REPLACEMENTSPRINCES TRUSTLIGHTJ. KING CARASCO JUAREZTHE SILENCERS PAINTEDTHE TRUTH UNTIL

BEDHYSTERIALITTLETOUCH

CDCDCDCD

(CD)

CD

(CD)

SOMETHINGDREAMSMIXED (CD)DARLINGSUNSET (CD)ISN'T

ROCKSOLITUDE (CD)TAKECARTEMPTATION(CD)

KLBJ-FM AUSTINP.D. CLARK RYANM.D. JEFF CARROLPH: 512-474-6543MUSIC:TUE AFTCALLS:MON-THU 12- 2

HEAVY ADDS

FLEETWOOD LITTLEMEDIUM

MAC LITTLEMEDWMI ADDSAEROSMITH DUDELIGHT ADDSTHE CUREMELVIN JAMES

POWERBRYAN ADAMS VICTIM

IGRATEFUL DEAD HELLJ.C. MELLENCAMP PAPER?RICHARD MARX SHOULDTOM PETTY MIXEDPATTY SMYTH, ISN'T

HEAVYJON BUTCHER WISHESDEF LEPPARD ANIMAL

*DEF LEPPARD WOMENFABULOUS TBIRDS SPELLGREAT WHITE ROCKJON ASTLEY JANEILOVERBOY NOTORIOUSROGER WATERS SUNSET

COUNTRY

HEAVENWHY

(CD)

(CD)

(CD)

CAR (CD)ISDETOX

DARKDEADWESTBOYS (CD)HOMESUGARWORLDMAN (CD)HEARTALEXMONEY

CHART KEY* = Top 5 Requests1.= Increased Rotation(CD) = CD Airplay

KLOL HOUSTONP.D. RICK LAMBERTM.D. HARVEY KOJANPH: 713-526-6855

HEAVY ADDS*AEROSMITHTHE CARS

MEDIUM ADDSDAVID BOWIEHOOTERSSTARSHIPWHITESNAKELIGHT ADDSREPLACEMENTS ALEX

HEAVYJON BUTCHERFLEETWOOD MACGREAT WHITEHEARTJON ASTLEYLOST BOYS ST

U2U2

WHITESNAKEMEDIUMTHE BRANDOS

*TTHEHE CULTCURE*DEF LEPPARDDEF LEPPARDDEF LEPPARDDEF LEPPARDDEF LEPPARD

EUROPEFABULOUS TBIRDS SPELL

/GRATEFUL DEAD HELLGRATEFUL DEAD PUSHGRATEFUL DEAD WESTSAMMY HAGAR BACKHEART BADINSIDERS GHOSTLOVERBOY NOTORIOUSRICHARD MARXTOM PETTY,PAUL KELLYITHE SILENCERSSUZANNE VEGAJOE WALSHJOE WALSHLIGHTBEAT FARMERSBRYAN ADAMSCROWDED HOUSEGLEN BURTNICKGRATEFUL DEADHOOTERSLIVING/DAY STMELVIN JAMESOUTFIELDSTARSHIPU2U2U2U2

YOUDUDE

NEVERSATELLITEBABYLONIS

WISHESLITTLEROCKWAITJANEGOODBULLETCOUNTRYSPANISHSTREETSHERE

CD

33

CD

(CD

GETTYSBURGWILDHEAVEN Et3iANIMALEXCITABLEHYSTERIALOVEROCKETDREAMERCARRIE

CDCDCDCDCDCDCDCD

SHOULDMIXED (CD)DARLINGPAINTED (CD)SOLITUDE

FUN Er%CAR

DARKVICTIMWORLDFOLLOWTOUCHJOHNNYWHEREWHYSINCEOVERFOUNDREDTREETRIP

KLOS LOS ANGELESP.D. CHARLIE WESTM.D. KURT KELLY/APDPH: 213-557-7250CON: ORAL ROBERTSCALLS:TUE-FRI 2- 4

LIGHT ADDSAEROSMITHTHE CARSHOOTERSINSIDERSMOTLEY CRUEMELVIN JAMESPETE BARDENS

POWER?BEAT FARMERSHEART

/HOOTERSJ.C. MELLENCAMPJOHN WAITEtJOE WALSHHEAVY/DAVID BOWIEBRYAN ADAMSGRATEFUL DEADSAMMY HAGAR?JON ASTLEYRICHARD MARXMUMCHARLIE DANIELS

/ROGER DALTREYDEF LEPPARDDEF LEPPARDDEF LEPPARDDIOEUROPE,FLEETWOOD MAC?GLEN BURTNICKGRATEFUL DEADLOU GRAMMtSAMMY HAGARLOVERBOYLIVING DAY STTOM PETTYTOM PETTY?PAUL KELLYTHE SILENCERSSTEPPENWOLFU2JOE WALSH

/WHITESNAKELIGHTBRYAN ADAMSBRYAN ADAMSTHE CULTSTEVE EARLEG. SATELLITESMASON RUFFNERNEIL YOUNGPETER WOLFREFUGEE

KLPX TUCSONP.D. LARRY MILESM.D. JACK GREENPH: 602-621-6711CON: JON SINTONMUSIC:TUE AFTCALLS:MON 11- 3

MEDIUM ADDSAEROSMITHDAVID BOWIECUTTING CREWSAMMY HAGAR

LIGHT ADDSGLEN BURTNICKSTEPPENWOLF

POWER38 SPECIAL BACKtBRYAN ADAMS VICTIMtEUROPE CARRIEGRATEFUL DEAD TOUCHHEART WHOHOOTERS JOHNNYJ.C. MELLENCAMP PAPERSTARSHIP OVERWHITESNAKE HERE

CD

CDCD

CDCDCD

DUDEDUDE (CD)(CD)

GHOSTWILD (CD)

YDREAMS

DARKWHO (CD)JOHNNYPAPERENCIRCLED (CD)CAR

NEVERVICTIMHELLEAGLESJANE (CD)SHOULD

BOGGEDFIREANIMAL (CD)TEARWOMENDREAMERCARRIELITTLEFOLLOW

HOME

WEIFSTCD

NOTORIOUSCD

WHEREMIXEDRUNAWAY (CD)DARLING (CD)PAINTEDHOLDSTREETSHALFIS

FIREHEARTSDEVILSATISFIEDRAILROADGYPSYLONELYSTARTEDSURVIVAL

CRUZADOSROGER WATERSMEDIUMBEAT FARMERSTHE CARSDEF LEPPARDDEF LEPPARDFABULOUS TBIRDSGRATEFUL DEADGREAT WHITEtINSIDERSJON ASTLEYLOVERBOYRICHARD MARX,MOTLEY CRUEMELVIN JAMESMR. MISTERPETE BARDENSTOM PETTY

DUDE

LOVERHOME

FOLLOWHOLD

BEDSUNSET

DARK

ANIMALWOMENSPELLHELLROCKGHOST

NOTORIOUSSHOULDWILDWHYSOMETHINGDREAMSMIXED

August 21,

(CD)

(CD)

CD

(CD)

(CD)

(CD)

(CD)

(CD)

(CD)

CDCDCDCD

CDCDCDCDCD

PATTY SMYTHU2JOE WALSHWARREN ZEVONLIGHTTHE CULTMASON RUFFNERPAUL KELLYTHE SILENCERSURGENT

ISN'T (CD)STREETSCARDETOX

WILD (CD)WORLDDARLING (CD)PAINTEDTAKE (CD)

KMBY MONTEREYP.D. RICH BERLINM.D. STEVE HOOVERPH: 408-394-9000MUSIC:TUE AFTCALLS:MON-FRI 02-05

MEDIUM ADDSAEROSMITH DUDETHE CARS YOUUGTHHTE CALL INROGER DALTREY FIREREPLACEMENTS ALEXTNT STWHITESNAKE ISAR

POWERCRUZADOS BED (CD)GRATEFUL DEAD HELLGREAT WHITE ROCK (CD)HOOTERS JOHNNYJ.C. MELLENCAMP PAPERHEAVYBEAT FARMERS DARKBRYAN ADAMS VICTIMJON BUTCHER WISHES (CD)THE CALL WANNADIO DREAM

tFABULOUS TBIRDS SPELLERGLEN BURTNICK FOLLOWGRATEFUL DEAD TOUCH (CD)GREGG ALLMAN RUNNINGSAMMY HAGAR BOYSJOHN HIATT THANKINSIDERS GHOSTLOVERBOY NOTORIOUSLIVING/DAY ST WHERERICHARD MARX SHOULDOUTFIELD SINCEPAUL KELLY DARLINGTHE SILENCERS PAINTEDPATTY SMYTH ISN'TJOE WALSH CARWHITESNAKE HEREY&T CONTAGIOUSMEDIUM38 SPECIAL BACKLA SAMBA ST SAMBADAVID BOWIE NEVERCHARLIE DANIELS BOGGEDCROWDED HOUSE WORLDtDEF LEPPARD ANIMALDEF LEPPARD WOMEN?FLEETWOOD MAC LITTLELOU GRAMM READY

HOMEt

HAMMYT HAGAREARSATELLITE

tJON ASTLEY JANELOST BOYS ST GOOD

/MELVIN JAMES WHYMR. MISTER SOMETHINGNEIL YOUNG LONELY?PETE BARDENS DREAMSTOM PETTY MIXEDROGER WATERS SUNSETSTAN CAMPBELL YEARSSTARSHIP BABYLONSTEPPENWOLF HOLDSUZANNE VEGA SOLITUDEWORLD PARTY ALLWENDY WALDMAN LIVINGWARREN ZEVON DETOX

LIGHTTHE BRANDOS GETTYSBURGSTEVE EARLE SATISFIEDEUROPE CARRIEGRATEFUL DEAD PUSHGUNS N. ROSES WELCOMEJOHN HIATT THING

KM X LITTLE ROCKP.D. TOM WOOM.D. DAVID A. ROSSPH: 501-433-0123CON: JEFF POLLACKMUSIC:TUE AFTCALLS:MON 11- 1

HEAVY ADDS*AEROSMITHMEDIUM ADDSTHE CARSINSIDERSMR. MISTERLIGHT ADDSGLEN BURTNICK

HEAVY/LA BAMBA STTHE CALLCRUZADOS

*DEF LEPPARDGRATEFUL DEAD

*GREAT WHITE*HOOTERS

RICHARD MARXOUTFIELDTOM PETTYPATTY SMYTHTWISTED SISTERLIGHT38 SPECIALJON BUTCHERFLEETWOOD MACSAMMY HAGARHEARTMOTLEY CRUEPETE BARDENS

U2POISON

JOHN WAITEJOE WALSHWHITESNAKE

KMOD TULSA

DUDE

YOUGHOSTSOMETHING

FOLLOW

BAMBAWANNABED (CD)WOMENTOUCH (CD)ROCKJOHNNY

*J.C. MELLENCAMP PAPER?JON ASTLEY JANE (CD)LOST BOYS ST GOODROGER WATERS SUNSETWHITESNAKE HEREMEDIUMBEAT FARMERS DARKDAVID BOWIE NEVER

JON BUTCHERBRYAN ADAMS VICTIM

HOLYCDCD

CHARLIE DANIELS BOGGEDDIO DREAMEREUROPE ROCK (CD)FLEETWOOD MAC MIDNIGHTGRATEFUL DEAD HELLSAMMY HAGAR BOYS

NOTORIOUS

SINCEMIXEDISN'THOT

BACKWISHESTANGOGIVEWHOGIRLSDREAMSACTIONFOUND

CATIRMESIS

(CD)

(CD)

(CD)

(CD)

P.D. JIM JONESM.D. JOHN FOSTERPH: 918-664-2810CON: CHARLIE WEST/ORAL ROBERTSMUSIC:TUE AFTCALLS:MON-TUE 11-12

HEAVY ADDSDEF LEPPARD ANIMALGRATEFUL DEAD HELL

MEDIUM ADDSFLEETWOOD MAC LITTLELIVING/DAY ST WHERELIGHT ADDSBRIAN MCDONALDD.L. JONESIQ

POWER*GREAT WHITE ROCKSAMY HAGAR BOYS*J.MC. MELLENCAMP PAPER*WHITESNAKE HEREHEAVY(BRYAN ADAMS VICTIMDEF LEPPARD WOMEN

*SAMMY HAGAR EAGLES

1987

LIFEBONNIEPROMISES

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (44)

THE REPORTStHOOTERS JOHNNYJOE WALSH CARJOE WALSH HALF

MEDIUMBEAT FARMERS DARKJON BUTCHER WISHESTHE CALL WANNACHARLIE DANIELS BOGGEDCROWDED HOUSE WORLDCRUZADOS BEDTHE CULT WILDDIO DREAMERFABULOUS TBIRDS SPELLtJOHN HIATT THINGINSIDERS GHOSTJON ASTLEY JANELOVERBOY NOTORIOUSMARILLION SUGAR/RICHARD MARX SHOULDMASON RUFFNER WORLD

SOMETHINGLONELYMIXEDDARLINGPOWERSPAINTEDHOLDDANCEDETOX

MR. MISTERNEIL YOUNGTOM PETTYPAUL KELLYROGER WATERSTHE SILENCERSSTEPPENWOLFTOM KIMMELWARREN ZEVON

LIGHTTHE CAUSEGLEN BURTNICKHELIXMOTLEY CRUEMELVIN JAMESOMAR/HOWLERSSUZANNE VEGATESLATNTURGENTWENDY WALDMAN

MAC LONG BEACHP.D. TOM MARSHALLM.D. ROSS GOZAPH: 213-775-8172CON: JEFF POLLACKMUSIC:MON AFTCALLS:FRI 12- 5

NOFOLLOWWILDWILDWHYMANSOLITUDE

STARROCK

TAKELIVING

POWER ADDSAEROSMITH DUDEHEAVY ADDSDISORDERLIES ST EDGE

MEDIUM ADDS

TNTLIZZY BORDEN

WASP

POWERDEF LEPPARDDEF LEPPARDSAMMY HAGAR

*WHMOTITESLEY

NAKECRUE

HEAVYACE FREHLEYTHE CULTDEF LEPPARDDIODIO

MEHEARTSCREAM

ANIMALWOMENBOYS (CD)NAMECHILDREN

(CD)

ROCKWILD (CD)LPEAMER

EVDRIL*FASTER puss*CAT CHANGE*GUNS N. ROSES WELCOMEtGREAT WHITE REDSAMMY HAGAR WHENHEATHEN SETHELIX WILDMOTLEY CRUE WILDPOISON FORGETTWISTED SISTER HOTY&T TEMPTATION

MEDIUMTHE ANGELS WHEN*GUNS N' ROSES MRHELLOWEEN HALLOWEENSHYSLADE

EMERGENCY

SWORD CHILDRENTONY MACALPINE KEYWHITE LION ALL

KNCN CORPUS CHRISTIP.D. TIM PARKERPH: 512-289-1000MUSIC:TUE AFTCALLS:MON 3- 5

HEAVY ADDSAEROSMITH DUDETHE CARSMEDIUM! ADDS

YOU

GLEN BURTNICK FOLLOWPAUL KELLY DARLING

LIGHT ADDSWID

JOHNHELIX HIATT THING

POWER*DEF LEPPARD WOMENGRATEFUL DEAD HELLGRATEFUL DEAD TOUCHJ.C. MELLENCAMP PAPERtLOVERBOY NOTORIOUSOUTFIELD AMERICAOUTFIELD HEARTHEAVYBRYAN ADAMS VICTIM*JON BUTCHER WISHESTHE CULT WILD (CD)DIO*EUROPE CARRIEFABULOUS THIRDS SPELLFLEETWOOD MAC LITTLEGREAT WHITE ROCKSAMMY HAGAR BOYStHOOTERS SATELLITEMASON RUFFNER WORLDOMAR/HOWLERS MANU2JOE WALSH CAR*WHITESNAKE ISWARREN ZEVON DETOX

,MEDIUMACE FREHLEY ROCKBEAT FARMERS DARKTHE CURE HEAVENDEF LEPPARD ANIMAL

*FASTER puss*CAT CHANGESAMMY HAGAR HOME

INSIDERS,LIVING/DAY STtRICHARD MARXMOTLEY CRUEMR. MISTERNEIL YOUNGPETE HARDENSTOM PETTYSTARSHIPTESLAURGENTYiT

UGHTDAVID BOWIEGUNS N' ROSESMELVIN JAMESROGER WATERSTHE SILENCERS

GHOSTWHERESHOULDWILDSOMETHINGLONELYDREAMSMIXEDBABYLONROCKTAKETEMPTATION

NEVERWELCOMEWHYSUNSETPAINTED

KOAS KEALAKEKUAP.D. MIKE GARDNERPH: 808-323-2011MUSIC:WED AFTCALLS:WED-THU 9- 5

HEAVY ADDSREPLACEMENTSSTARSHIP

MEDIUM ADDS38 SPECIALTHE CARSNEIGHBORHOODS

HEAVYANDY TAYLOR WINDOWBRYAN ADAMS NATIVETHE CALL WANNACHARLIE DANIELS BOGGEDCRUZADOS BEDROGER FIRE*FABULOUSDALTREYTHIRDS NUMBERDAN FOGELBERG EXILES

ALEXBABYLON

SAMEYOUPURE

GRATEFUL DEAD TOUCH/SAMMY HAGARJOHN HIATT

HOMETHING

HOOTERS SATELLITEtINSIDERS GHOSTJ.C. MELLENCAMP PAPERLOST BOYS ST PEOPLENEIL YOUNG PRISONERS

VALENTINESUNSETJUSTICEHEARTACHEISN'T

HOLDKEEPFACTORY

REPLACEMENTSROGER WATERSROBERT VAUGHNPATTY SMYTHPATTY SMYTH

*STARSHIPSTEPPENWOLFWETTON/MANZARAWARREN ZEVON

MEDIUM10,000 MANIACSTHE CALLBRUCE co*ckBURNTHE CULTDAVE PERKINSECHO/BUNNYMENFLEETWOOD MACFIRE TOWNGLEN BURTNICKGLEN BURTNICKHEARTINNER SPACE STLOST BOYS STLIVING/DAY ST WHEREM. CRENSHAW MARYRICHARD MARX SHOULDMASON RUFFNER UNDERPETE BARDENS ALIVEPAUL JANZ ONEREFUGEE SURVIVALREPLACEMENTS NEVERROBERT VAUGHN SPANISHSCRUFFY THE CAT MYSCOTT FOLSOM LISTENSTARSHIP CHILDRENSTEPPENWOLFLITTLE STEVENTHE TRUTHUB40URGENTIN VITROJOE WALSH GUMJOE WALSH TIMEWEDNESDAY WEEK WHY

1391.1triatEM.D. STEPHEN PAGEPH: 408-985-9800CON: JEFF POLLACKMUSIC:TUE AFTCALLS:FRI 1- 5

POWER ADDSTHE CARS YOUHEAVY ADDSAEROSMITH DUDEDISORDERLIES ST EDGE

MEDIUM ADDSHEARTMELVIN JAMESJOE WALSH

POWERCRUZADOS BEDtDEF LEPPARD WOMENGRATEFUL DEAD HELLJ.C. MELLENCAMP PAPERPATTY SMYTH ISN'THEAVYBACK/BEACH ST CATCHDAVID BOWIE NEVERBRYAN ADAMS VICTIMJON WISHES

*CHARLIEBUTCHERDANIELS BOGGEDGRATEFUL DEAD WESTSAMMY HAGAR BOYS*SAMMY HAGAR HOMEHOOTERS JOHNNYJON ASTLEYLOVERBOY

*ROGER&T WATERS

WARREN ZEVONMEDIUM38 SPECIAL

.BEAT FARMERSTHE CALLCROWDED HOUSEDEF LEPPARDDIOEUROPEGLEN BURTNICKINSIDERSRICHARD MARXMR. MISTERPETE BARDENSTOM PETTYPAUL KELLYTHE SILENCERSSTARSHIP

JANENOTORIOUSSUNSETTEMPTATIONDETOX

0;(CD)

(CD)

BACKDARKWANNAWORLDTEARDREAMERCARRIEFOLLOWGHOSTSHOULDSOMETHINGSEASCAPEMIXED (CD)DARLINGPAINTEDBABYLON

STEPPENWOLF GIVETWISTED SISTER HOTURGENT TAKEWHITESNAKE HERE

KOZZ RENOP.D. STEVE FUNKM.D. HARRY REYNOLDSPH: 702-329-9261CON: B -A -D -EMUSIC:TUE MORCALLS:FRI-MON

HEAVY ADDSAEROSMITHTHE CARSMEDIUM ADDSBILLY IDOLDEF LEPPARDHEARTWHITESNAKELIGHT ADDSCUTTING CREWMR. MISTERTHE SILENCERS

HEAVYtDEF LEPPARD EXCITABLE*GRATEFUL DEAD TOUCHISAMMY HAGAR HOMEHOOTERS JOHNNYJ.C. MELLENCAMP PAPERJON ASTLEY JANE*U2 STREETSWHITESNAKE HEREMEDIUM*BACK/BEACH STBRYAN ADAMS

*JON BUTCHERCRUZADOS

*THE CULTTHE CURE

PEACEWOODSSTOLENWILDYOUGAMEMIDNIGHTPLACESFOLLOWHEARDWHO

LETWILL

FEELUNTILCHERRYTAKE

BADWHYCAR

YOUDUDE

MONYGODSWAITIS

LOVESOMETHINGPAINTED

ROCKSATELLITEGHOSTNOTORIOUSWHEREFLYINGDREAMSDARLING

'ROBERT CRAY GUESSROGER WATERS SUNSETSTARSHIP BABYLON}STARSHIP BABYLON

GIVELIGHTTHE BEARS FEARBEAT FARMERS DARKBRUCE co*ckBURN WAITINGDIO DREAMERJUDAS PRIEST ANOTHERRICHARD MARX SHOULDOMAR/HOWLERS MANROBERT VAUGHN JUSTICEPATTY SMYTH ISN'T

PIPELINEVICTIMWISHESBEDWILDHEAVEN

DEF LEPPARD ANIMALFABULOUS TBIRDS SPELL

tGLEN BURTNICK FOLLOWGRATEFUL DEAD HELLGRATEFUL DEAD STONESGRATEFUL DEADGREAT WHITEHOOTERSINSIDERSLOVERBOYLIVING/DAY STOZZY OSBOURNEPETE HARDENS

(CD)

(CD)

(CD)

(CD)

KPEZAUSTINP.D. BRENT CLANTONM.D. DOC PHILLIPSPH: 512-478-6900CON: CHARLIE WESTMUSIC:MON AFTCALLS:MON-TUE 11-02

MEDIUM ADDSAEROSMITHDB'SX SEES

POWERLA BAMBA ST SUMMERTIMETOM.KIMMEL FREEDOM

HEAVYLA BAMBA ST BAMBAJON BUTCHER WISHESTHE CALL WANNA (CD)CRUZADOS BEDSTEVE EARLE SATISFIEDFABULOUS THIRDS STANDFLEETWOOD MAC TANGOGRATEFUL DEAD HELLGRATEFUL DEAD TOUCHGRATEFUL DEAD WESTHEART WHO

.J.C. MELLENCAMP PAPEROMAR/HOWLERS DANCINGTOM PETTY DAMAGEROBERT CRAY WOMAN

MEDIUMTHE BEARS FEARBEAT FARMERS DARKTHE BRANDOS GETTYSBURGBRYAN ADAMS FIREBRYAN ADAMS HEARTSBRYAN ADAMS VICTIMTHE CALL WOODSCHARLIE DANIELS BOGGEDROGER DALTREY TAKEELTON JOHN CANDLE

*JOE ELY LORD*FABULOUS THIRDS NUMBER*FABULOUS THIRDS SPELL (CD)FLEETWOOD MAC LITTLEGREAT WHITE ROCKSAMMY HAGAR GIVE 0;HOOTERS JOHNNYINSIDERS GHOSTJON ASTLEY JANELIVING/DAY ST WHEREM. CRENSHAW MARYRICHARD MARX SHOULDMASON RUFFNER WORLD (CD)MELVIN JAMES WHYNEIL YOUNG QUEENOMAR/HOWLERSPAUL CARRACK SHEDPAUL KELLY DARLINGTHE SILENCERS PAINTEDPATTY SMYTH ISN'TSTEPPENWOLF HOLDSUZANNE VEGA SOLITUDE

JOHNSTREETSWAITE TIMES (CD)JOE WALSH CARJOE WALSH RADIOWARREN ZEVON HYGIENELIGHT10,000 MANIACS PEACEBACK/BEACH ST PIPELINEBACK/BEACH ST WOOLYCROWDED HOUSE WORLDTHE FIXX REDLOST BOYS ST GOOD

19'1N. GREG L1,11JULNILYM.D. ANDY PRESTONPH: 808-524-7100CON: LARRY BRUCEMUSIC:TUE AFTCALLS:MON-TUE 10-12

MEDIUM ADDS*AEROSMITHTHE CARSHOOTERSLIGHT ADDSUB40

DUDEYOU

CHERRY

POWERCRUZADOS BED

WOMEN(CD)

DEF LEPPARDGRATEFUL DEAD TOUCH RIHEART WHOHOOTERS JOHNNYJ.C. MELLENCAMP PAPER 0;JON ASTLEY JANETOM PETTY MIXEDU2 STREETS imWHITESNAKE HERE

HEALA BAMBA ST BAMBA (CD)BEAT FARMERS DARK/DEF LEPPARD ROCKETFABULOUS TBIRDS SPELLGRATEFUL DEAD HELLGRATEFUL DEAD PUSH T11SAMMY HAGAR BOYS CD*LOVERBOY NOTORIOUS*LIVING/DAY ST WHEREROGER WATERS SUNSET (CD)PATTY SMYTH ISN'T CDJOE WALSH CAR CDWARREN ZEVON DETOXMEDIUMBACK/BEACH ST PIPELINEDAVID BOWIE BANG CDBRYAN ADAMS VICTIM CDTHE CALL CD

CDTHE CULT WILDTHE CURE CDTHE CURE WHY CDDEF LEPPARD TEAR CDECHO/BUNNYMEN NEWGREAT WHITE ROCK (CD)INSIDERS GHOSTLOST BOYS ST PEOPLELIME SPIDERS NSURICHARD MARX SHOULD (CD)MASON RUFFNER WORLD

*MELVIN JAMES WHYPAUL KELLY DARLINGPRIVATE DOMAIN ABSOLUTETHE SILENCERS PAINTED (CD)SIMPLE MINDS MIRACLETONIO K SEX (CD)WARREN ZEVON MONKEYLIGHTDEPECHE MODE STRANGEICICLE WORKS JANEGARY HUMAN RADIOPETE WYLIE SINFULx JULY (CD)

KIDS DULUTHP.D. MIKE KELLERM.D. WADE LINDERPH: 218-728-6421MUSIC:TUE AFTCALLS:MON 11- 1

HEAVY ADDSTHE CARS

MEDIUM ADDSAEROSMITHROGER DALTREYGRATEFUL DEADINSIDERS

YOU

DUDEFIREHELLGHOST

HEAVYCRUZADOS BEDIDEF LEPPARD ANIMALGRATEFUL DEAD TOUCH

*GREAT WHITE ROCKHOOTERS JOHNNY

IJ.C. MELLENCAMP PAPERJON ASTLEY JANELOST BOYS ST GOODRICHARD MARX SHOULDTOM PETTY DAMAGEU2 SJOE WALSH CAR

MEDIUMBEAT FARMERS DARKBRYAN ADAMS VICTIMTHE CALL WANNA

*DEF LEPPARD WOMENFABULOUS THIRDS SPELL

FCDDI

(CD)

(CD)

CDCDCDCDCDCD

CDCD

CD

GLEN BURTNICKGRATEFUL DEADSAMMY HAGARSAMMY HAGARHEARTHOOTERSLOVERBOYMELVIN JAMESMR. MISTERPAUL KELLYROGER WATERSROGER WATERSSUZANNE VEGAJOHN WAITEJOHN WAITE

*WHITESNAKELIGHTBRIAN MCDONALD LIFEREPLACEMENTS ALEX

WESTW

PE IBOMS

CDTOUGHSATELLITENOTORIOUSWHYSOMETHINGDARLING CD

WHOSUNSET

CDSOLITUDE CDSOMETIMES CDTIMES CDHERE CD

?DRS MINNEAPOLISP.D. DAVE HAMILTONM.D. JOHN LASSMANPH: 612-545-5601

MEDIUM ADDSAEROSMITH DUDESAMMY HAGAR HOME

POWERBEAT FARMERS DARKCHARLIE DANIE BOGGED*DEF LEPPARDLS ANIMALG. SATELLITES MYTH (CD)*GREAT WHITE ROCKSAMMY HAGAR GIVE (CD)HOOTERS JOHNNYtJ.C. MELLENCAMP PAPER (CD)WHITESNAKE HERE (CD)

HEAACVYE FREHLEY INTO

DEF LEPPARD LOVEDEF LEPPARD WOMENGRATEFUL DEAD HELL

tHGRATEART

GIRLEFUL

DEAD TOUCH

HEART WHOtLOVERBOY NOTORIOUSU2 WITH (CD)

MEDIUM*BRIAN MCDONALD LIFEDAVID BOWIE 87BRYAN ADAMS FIRE (CD)BRYAN ADAMS HEAT (CD)LAMONT CRANSTON TWOTHE CULT DEVILTHE CULT WILD (CD)ROGER DALTREY FIRE010 DREAMER

GENESIS DEEP (CD)*GREGG ALLMAN ANGELGUNS N. ROSES WELCOMEINSIDERS GHOSTLOST BOYS ST GOODM. CRENSHAW EASYRICHARD MARX MEANMOTLEY CRUE WILDMELVIN JAMES WHYNEIL YOUNG EYESOVER THE TOP ST WINNERTOM PETTY MEPAUL KELLY DARLINGREPLACEMENTS LEDGEROGER WATERS SUNSETSTEVIE RAY WILLIE*STEPPENWOLF LIFEWHITESNAKE STILL

KOWB-FM FARGOM.D. BANKS SA STEELEPH: 218-236-7900MUSIC:MON AFTCALLS:TUE-THU 10-12

HEAVYADDS*AEROSMITHMEDIUM ADDSTHE CARSTHE CULTFLEETWOOD

CD

(CD)

(CD)

(CD)

DUDE (CD)

YWILD

MAC LITTLE (CD)

POWERJON BUTCHERCRUZADOSGRATEFUL DEADHOOTERSJ.C. MELLENCAMPLIVING/DAY ST

HEAVYREPLACEMENTS

LA BAMBA STBEAT FARMERSDAVID BOWIEDAVID BOWIE

*DEF LEPPARDEUROPEFABULOUS THIRDS

*GLEN BURTNICKGREAT WHITEINSIDERSMASON RUFFNERMOTLEY CRUETOM PETTYPAUL KELLYROGER WATERSTHE SILENCERSU2URGENTJOE WALSHWARREN ZEVONMEDIUMTHE BRANDOSBRYAN ADAMSCHARLIE DANIELSDEF LEPPARDDIOFABULOUS TBIRDS

*GRATEFUL DEADGREGG ALLMANJON ASTLEYLITTLE AMERICALOVERBOYRICHARD MARXMOTLEY CRUEMELVIN JAMESGARY MOOREMR. MISTERNEIL YOUNGOUTFIELDJEFF PARISPETE BARDENSSUBURBSSTEPPENWOLFTESLATWISTED SISTER

WISHESBEDTOUCHJOHNNYPAPERWHEREALEX

CD)

CD

(CD)

(CD)

BAMBADARKBANG CDNEVER CDWOMENCARRIESTAND

CD

FOLLOWROCK (CD)GHOSTWORLDGIRLS

IR!MIXEDDARLING CDSUNSETPAINTEDSTREETS (CD)TAKECARDETOX

(CD)

GETTYSBURGVICTIM (CD)BOGGEDANIMALDREAMER 'CDSPELL

CDHELL CRUNNING CDJANE

CDWAY CNOTORIOUSSHOULD (CD)WILDWHYWILD (CD)SOMETHINGLONELYHEART CDSATURDAY 1CDDREAMS CDLITTLEHOLDROCKHOT (CD)

KRCK OMAHAP.D. PAUL KRIEGLERPH: 402-553-0980MUSIC:MON AFTCALLS:TUE 1- 6

MEDIUM ADDSDB'SSTEVE JONESTHAT PETROL EMOLIGHT ADDSBALANCING ACTFOLK DEVILSSECTION 25

August 21, 1987

LIEWITHSWAMP

LP12.BAD

CHART KEY* = Top 5 Requests

= increased Rotation(CD) = CD Airplay

Radio Reports...Monday & Tuesday10am - 7pm EST

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (45)

THEHARD REPORT REPORTS

POWERTHE CURE LP P;DEAD MILKMEN LPECHO/BUNNYMEN LPGO-BETWEENS LPMIGHTY LEMON DR LPNEW ORDER LPREPLACEMENTS LP (CD)

HEAVYLONELY/EYESORE LP (CD)FACTORY COMPIL. LPHURRAH LP (CD)JESUS/MARY CH APRILNITZER EBB MURDEROUS (CD)THAT PETROL EMO BIG (CD)TOM VERLAINEUB40 JERRY

LPMEDIUMBACK/BEACH ST PIPELINEBEAT FARMERS LPTHE BRANDOS GETTYSBURG(CD)DEPECHE MODE STRANGEDOWNY MILDEW LPERASURE LP (CD)ICICLE WORKS EVANGELINEICICLE WORKS JANELAIBACH LPLOST BOYS ST PEOPLELIME SPIDERS LPMOOD SIX

PURENEW

PURENEW ORDER 1963PAUL KELLY DARLING (CD)

(ROYAL COURT.... CHANGEDREDD KROSS PLAY (CD)THE SAINTS TEMPLESCRUFFY THE CAT LP (CD)SIOUXSIE PASSENGERSKINNY PUPPY DEEPSIMPLE MINDS MIRACLESONIC YOUTH LP (CD)SPEAR LPWINDBREAKERS/DgSTINY LPWIRE AMBITIOUSLIGHT10,000 MANIACS TALK (CD)NEW MODEL ARMY LPANDY SUMMERS LOVEY. FRESH FELLOW LPHAPPY MONDAYS LPNICE STRONG ARM LPSLOVENLY LPWAILING/COMPIL. LP (CD)WILD FLOWERS LP

KRIX BROWNSVILLEP.D. SONNY CUELLARM.D. JOE KELLEY/APDPH: 512-546-9900MUSIC:TUE MORCALLS:THU 10-1

HEAVY ADDSAEROSMITHMEDIUM ADDSTHE CARSCUTTING CREWLIGHT ADDSENVYTOM KIMMEL

HEA*DEFVY LEPPARDGRATEFUL DEADHOOTERS*J.C. MELLENCAMP*JON ASTLEY*PETE BARDENS

U2*WHITESNAKEMEDIUMTHE BEARSBRYAN ADAMS*JON BUTCHERTHE CALLCRUZADOSDEF LEPPARDDEF LEPPARDDIOEUROPEFABULOUS TBIRDSFLEETWOOD MACGRATEFUL DEADGREAT WHITESAMMY HAGARSAMMY HAGARLOVERBOYLIVING/DAY STRICHARD MARXOMAR/HOWLERSROGER WATERSSTEPPENWOLFSUZANNE VEGA

LIGHTBEAT FARMERSTHE CULTINSIDERSMASON RUFFNERMOTLEY CRUEPAUL KELLYTHE SILENCERS

DUDE (CD)

YOULOVE

BELIEVEDANCE

EXCITABLETOUCH (CD)JOHNNYPAPERJANEDREAMS (CD)STREETSWITHHERE

FEARVICTIMWISHESWANNABEDANIMALWOMENDREAMERCARRIECOMMONLITTLEHELLROCK (CD)

HOMENOTORIOUSWHERESHOULD

SUNSETHOLDSOLITUDE

WILDGHOSTWORLDWILDDARLINGPAINTED

KROO. PASADENAP.D. RICK CARROLLM.D. LARRY GROVESPH: 818-953-7667

ADDSTHE CARS YOUSURF MCSXECHO

1

2

3

4

5

6

7

8

9

1011121314151617181920212223242526272829303132333435363738

SEESUGAR

TONIO KTHE CUREABCXINXS

SEXLPSMOKEYFOURTHGOODEY

REPLACEMENTS LPFIXX SCAREDCRUZADOS BEDECHO/BUNNYMEN GAMELOS LOBOS LPPRIVATE DOMAIN PANTODEPECHE MODE STRANGEPET SHOP BOYS SINGARY NUMAN LPVARREN ZEVON LPTHE CULT LPICICLE WORKS JANEDURAN DURAN LPU2 LPNEW ORDER LPBOLSHOI PLEASEDAVID BOWIE LPWANG CHUNG LPJON ASTLEY JANEERASURE SOMETIMESSIOUXSIE LPSIMPLE MINDS LPBOY GEORGE LPFATBOYS WIPESILENCERS LPA HA LPCOLOURFIELD LPFIGURES/BEACH STARSUB40 CHERRYPAUL KELLY LPDANNY ELFMAN HAPPYBANANARAMA HEARDZETTE FREAK

KRQR SAN FRANCISCOP.D. CHRIS MILLERM.D. JOHN MC CRAEPH: 415-765-4045

HEAVY ADDSTHE CARS YOUCRUZADOS SMALLHOOTERS SATELLITEWHITESNAKE IS

MEDIUM ADDSAEROSMITH DUDE

LIGHT ADDSBRIAN MCDONALD LIFEFABULOUS TBIRDS SPELL

POWERDEF LEPPARD WOMEN/GRATEFUL DEAD HELLHOOTERS JOHNNYJ.C. MELLENCAMP PAPERU2 ETSSTREWHITESNAKE HERE (CD)

HEAVYBEAT FARMERS DARKBEAT FARMERS HOLLYWOODCRUZADOS BED (CD)DEF LEPPARD ANIMALDEF LEPPARD GODSDEF LEPPARD HYSTERIA (CD)DEF LEPPARD SHOOTGRATEFUL DEAD STONESSAMMY HAGAR BOYSSAMMY HAGAR HOME (CD)SAMMY HAGAR WHENROGER WATERS POWERSROGER WATERS SUNSET

MEDIUMDAVID BOWIE NEVER (CD),BRYAN ADAMS VICTIMTHE CALL WANNA (CD)GLEN BURTNICK FOLLOWGREAT WHITE ROCK

iggiHEART BADHEART

GHOST(CDINSIDERS GHOST

LOVERBOY NOTORIOUSRICHARD MARX SHOULDMASON RUFFNER WORLD/MELVIN JAMES WHYMR. MISTER SOMETHINGPETE BARDENS DREAMSTOM PETTY MIXEDPAUL KELLY DARLINGTHE SILENCERS PAINTED (CD)JOE WALSH CARWARREN ZEVON DETOX

LIGHTCHARLIE DANIELS BOGGEDco*ck ROBIN JUSTDIO DREAMER (CD)EUROPE CARRIE (CD)JON ASTLEY LIPMARILLION SUGARMOTLEY CRUE GIRLS

CD

NEIL YOUNG AROUNDOUTFIELD SINCEROCK AND HYDE WILL (CD)REFUGEE SURVIVALGREGG ROLIE HANDSSTAN CAMPBELL YEARSSTARSHIP BABYLON PiTESLA ROCKURGENT TAKEY&T TEMPTATION

KRQU LARAMIEP.D. BOB ELYM.D. KEVIN LEWISPH: 307-745.-7396CON: JOHN EDWARDSMUSIC:MON AFTCALLS:MON-FRI 3- 5

HEAVY ADDSAEROSMITHTHE CARSMEDIUM ADDSCUTTING CREWCROWDED HOUSEFASTER puss*CATFLEETWOOD MACPSEUDO ECHOPRETTY MAIDSTOM KIMMELY&T

POWERILOVERBOY*OUTFIELDISKAGARACKUHEAVYRGENT

BRYAN ADAMS VICTIM*DEF LEPPARD WOMEN*DISORDERLIES ST EDGEEUROPE CARRIEJOHN FARNHAM PRESSUREGREAT WHITE ROCKHOOTERS JOHNNYJ.C. MELLENCAMP PAPERLOST BOYS ST SHADOWSRICHARD MARX SHOULD*MELVIN JAMES WHYTHE SILENCERS PAINTED

prITESNAKEIS

MUMBEAT FARMERS DARKDAVID BOWIE NEVERCURIOSITY/CAT MISFITDIO DREAMERFROZEN GHOST PROMISESGLEN BURTNICK FOLLOWSAMMY HAGAR BOYS

INSIDERSHET OR WH

GHOSTMOTLEY CRUE WILDMR. MISTER SOMETHINGPAUL KELLY DARLING

TARTNTSTEPPENWOLF HOLD

SU2 STREETSJOE WALSH CARWHITE LION WAIT

LIGHTTHE CURE HEAVEN (CD

DUDEYOU (CD)

LOVEWORLD(CD))CHANGELITTLE (CD)LISTENINGLOVDANCE CDTEMPTATION

NOTORIOUSHEART

TAKEALONE (CD)

KRXCI SACRAMENTOP.D. RON GARRETTPH: 916-334-7777CON: LARRY BRUCEMUSIC:TUE AFTCALLS:MON-TUE -9- 3

HEAVY ADDSAEROSMITHTHE CARSLIGHT ADDSFLEETWOODSW/

DUDEYOU

(CD)

piCD

(CD)

CD

jj

033

el61

19CDCD

MAC LITTLETEMPTATION

HEAVYDAVID BOWIEJON BUTCHERCRUZADOSDEF LEPPARDDIOGRATEFUL DEADGRATEFUL DEADGREAT WHITESAMMY HAGAR

NEVERWISHESBEDWOMENDREAMERHELLTOUCHROCKBOYS

HEART WHOHOOTERS JOHNNYJ.C. MELLENCAMP PAPERLOVERBOY NOTORIOUSSTARSHIP TRANSTESLA ROCKWHITESNAKE HEREMEDIUMBEAT FARMERS DARKTHE CALL WANNACHARLIE DANIELS BOGGEDCROWDED HOUSE WORLD*THE CULT WILDEUROPE CARRIEFABULOUS TBIRDS NUMBERFASTER puss*CAT CHANGE

,IINSIDERS GHOSTJON ASTLEY JANEMASON RUFFNER WORLD

(CD)

MOTLEY CRUEOUTFIELDPETE HARDENSTOM PETTYPAUL KELLYTHE SILENCERSJOE WALSHWETTON/MANZARAWARREN ZEVONLIGHTTHE CUREDEF LEPPARDGUNS N. ROSESRICHARD MARXOMAR/HOWLERSREFUGEEGREGG ROLIEURGENT

WILDPLAY (CD)DREAMSMIXEDDARLINGPAINTEDCARJUSTDETOX

HEAVENTEARWELCOMESHOULDDANCINGSURVIVALHTAKE

KRZO RENOP.D. DANIEL COOKM.D. DICK SHEETZPH: 702-827-0965

HEAVY ADDSTHE CARS

MEDIUM ADDSAEROSMITHTHE CALLDEF LEPPARDGLEN BURTNICKOMAR/HOWLERSPETER GABRIELWHITE LION

LIGHT ADDSPAT METHENY

HEL BAMBA STBRYAN ADAMSCZADOS*DEFRU LEPPARD*GREAT WHITE*HOOTERS

YOU

DUDEINANIMALFOLLOWMANWALKWAIT

LAST

BAMBAVICTBEDIMWOMEN

(CD)

ROCKJOHNNY

J.C. MELLENCAMP PAPER (CD)

tU2 STREETSLOVERBOY NOTORIOUS

JOE WALSH CAR*WHITESNAKE HERE (CD)MEDIUM38 SPECIAL SAMEACE FREHLEY ROCKBACK/BEACH ST PIPELINETHE BEARS FEARBEAT FARMERS DARKDAVID BOWIE NEVERJON BUTCHER WISHESCUTTING CREW LOVETHE

LEPPCULTARD

GODSDEFDEF LEPPARD HYSTERIADEF LEPPARD SHOOTDIO DREAMEREUROPE CARRIEFASTER puss*CAT CHANGE

*GRATEFUL DEAD HELLGRATEFUL DEAD TOUCHGRATEFUL DEAD WESTGUNS N. ROSES WELCOMEGREAT WHITE REDSAMMY HAGAR BOYSSAMMY HAGAR HOMESAMMY HAGAR WHENHOOTERS, SATELLITELOST BOYS ST SHADOWSLIVING/DAY ST WHERELOUDNESS HEARTMARILLION INCOMMUNRICHARD MARX SHOULDMOTLEY CRUE WILDMELVIN JAMES WHYMR. MISTER SOMETHINGPETE BARDENS DREAMSTOM PETTY MIXEDPAUL KELLY DARLINGREFUGEE SURVIVALROGER WATERS SUNSETGREGG ROLIE HANDSTHE

DESILENCERS PAINTED

SLATESLA ROCKTWISTED SISTER HOTURGENT TAKEJOE WALSH FUNWHITESNAKE ISPETE WYLIE SINFULWARREN ZEVON DETOX

KSHE ST. LOUISP.D. RICK BALISM.D. AL HOFERPH: 314-621-0095CON: JEFF POLLACKMUSIC:TUE AFT-MON 9-12

HEAVY ADDSTHE CARS YOUMEDIUM ADDSAEROSMITH DUDEBILLY IDOL MONY

HEAVY38 SPECIAL BACKBRYAN ADAMS VICTIMCHARLIE DANIELS BOGGED*CRUZADOS BEDDEF LEPPARD ANIMAL}DEF LEPPARD WOMEN(FABULOUS TBIRDS SPELLGRATEFUL DEAD HELL_SAMMY HAGAR BOYS*HOOTERS JOHNNYJ.C. MELLENCAMP PAPERLOST BOYS ST GOOD (CD)RICHARD MARX SHOULDPATTY SMYTH ISN'T (CD)U2 COUWHITESNAKE HERE

MEDIUMFABULOUS TBIRDS STANDFLEETWOOD MAC LITTLEGRATEFUL DEAD TOUCH (CD)GREAT WHITE ROCKHSAMMEART Y HAGAR GIVE

INSIDERS GHOSTLOVERBOY NOTORIOUSMR. MISTER SOMETHING (CD)PETE HARDENS DREAMSTOM PETTY MIXED (CD)ROGER WATERS SUNSETTHE SILENCERS PAINTED (CD)STARSHIP OVERSTEPPENWOLF HOLDTOM KIMMEL FREEDOMURGENT TAKE

KSJO SAN JOSEP.D. KEN ANTHONYPH: 408-288-5400CON: JON SINTONMUSIC:MON AFTCALLS:WED-THU 02-05

HEAVY ADDS*AEROSMITH DUDE*THE CARS YOUMEDIUM ADDSCUTTING CREW LOVEMOTLEY CRUE WILD

POWERBRYAN ADAMS VICTIMCRUZADOS BED (CD)HOOTERS JOHNNY

*J.C. MELLENCAMP PAPERLOST BOYS ST GOOD (CD)OUTFIELD SINCEU2 STREETSWHITESNAKE HERE

DAVID BOWIE NEVERTHE CALL WANNA (CD)CHARLIE DANIELS BOGGED*DEF LEPPARD ANIMALDEF LEPPARD GODS

August 21, 1

DEF LEPPARD WOMENGRATEFUL DEAD HELLGRATEFUL DEAD TOUCHGRATEFUL DEAD WEST CD*GREAT WHITESAMMY HAGAR

ROCK CDCD

JON ASTLEYLOVERBOY NOTORIOUS (CD)MR. MISTER SOMETHING (CD)TOM PETTY MIXEDSTARSHIP BABYLONJOE WALSH CARWARREN ZEVON DETOX (CD)MEDIUMBEAT FARMERS DARKJON BUTCHER WISHESTHE CULT WILDEUROPE CARRIE

(CD)FABULOUS TBIRDS SPELLSAMMY HAGAR BOYSINSIDERS GHOSTRICHARD MARX SHOULDMASON RUFFNER WORLDPETE BARDENS DREAMS CD)PAUL KELLY DARLING (CD)ROGER WATERS SUNSETTHE SILENCERS PAINTEDPATTY SMYTH ISN'TSTEPPENWOLF HOLDYLT TEMPTATION(CD)

KSOY RAPID CITYP.D. JACK DANIELSM.D. JEFF MICHAELSPH: 605-578-3533CON: JAY MITCHELL ASSOC.MUSIC:TUE AFTCALLS:MON-FRI 9-10

LIGHT ADDSAEROSMITHTHE BRANDOSTHE CARSDEF LEPPARDGLEN BURTNICKGREAT. WHITEINSIDERSSTARSHIP

HEAVYLA BAMBA STBRYAN ADAMSCHARLIE DANIELSCRUZADOSDEF LEPPARD

*GREAGRATT WEFUHITELDEAD

SAMMY HAGARHOOTERS

/INSIDERSJ.C. MELLENCAMPJON ASTLEYtRICHARD MARXTOM PETTYROGER WATERS

ITHESILENCERS

JOE WALSHMEDIUMBEAT FARMERSDAVID BOWIEJON BUTCHERTHE CALLCROWDED HOUSE?THE CULT*DEF LEPPARDDIOEUROPEFABULOUS TBIRDSFLEETWOOD MAC*GRATEFUL DEAD*SAMMY HAGARHOOTERSHUEY LEWIS/NEWS*LOVERBOYLIVING/DAY STMOTLEY CRUEMELVIN JAMESMR. MISTEROUTFIELDPETE HARDENSPAUL KELLYSTEPPENWOLFURGENTWARREN ZEVONLIGHTco*ck ROBINGRATEFUL DEADHEARTHELIXLITTLE AMERICASTEPPENWOLFSUZANNE VEGAJOE WALSHWHITESNAKE

DUDEGETTYSBURG

(CD)

YOUHYSTERIAFREOLLOWD (CD)

BABYLON(CD)

OtNIMBOGGEDBED

( CD(CD)

)

WOMENTOUCHROCK CD

WILY CD

GHOST

JANEPAPER

MVPSUNSET PiPAINTEDSTREETSCAR (CD)

DARKNEVERWISHES (CD)WANNAWORLDWILDANIMALDREAMERIE

(CD)SPELL

CDHELLHOME

CDLITTLE

SATELLITECD

ggIgRIOUWHERE

S

WILDWHYSOMETHINGHEART (CD)DREAMSDARLINGHOLDTAKE (CD)

plibEIT;GIRLWILDWAYGIVESOLITUDE

IS

)(TAO TAOSP.D. BILL EVANSPH: 505-758-1017MUSIC:TUE MORCALLS:TUE-WED 10-12FROZEN REPORT

HEAVYLA BAMBA STco*ck ROBINECHO/BUNNYMENJOE ELYFABULOUS TBIRDSGRATEFUL DEADJOHN HIATTJ.C. MELLENCAMPT. LAVITZLIVING/DAY STLIVING/DAY STLYLE LOVETTRICHARD MARXMOJO NIXONM. TOMLINSONPETE BARDENSPAUL KELLYPAT METHENYWARREN ZEVON

MEMUM10,000 MANIACSTHE BEARSBEAT FARMERSTHE BRANDOSJON BUTCHERTHE CALLTHE CALLTHE CALLCOLOURFIELDCROWDED HOUSECRUZADOSCRUZADOSDON DIXONDUANE EDDYSTEVE EARLEFLEETWOOD MACFIRE TOWNCHRIS ISAAKICICLE WORKSJON ASTLEYL. WAINWRIGHTMARILLIONM. CRENSHAWRICHARD MARXMOOD SIXMR. MISTERM. TOMLINSONNEIL YOUNGN. TREMULISRED 7RED 7GREGG ROLIESHELLYAN ORPHANTHE SILENCERSSUZANNE VEGATHIRD WORLDU2U2JOE WALSHWORLD PARTYLIGHTBACK/BEACH ST

987

JUSTNEWLORDLPTOUCHLP

PLPAPERIFWHERELPLPELVISBELIEVEDREAMSLPLASTRECONSIDER

LPEACEP

GELPTTYSBURGWISHESIN

WANNAMISSINGWORLDBEDBLUEHEARTLPANGRYLPLPLPSWEETJANELPLPLPSHOULD

SOMETHINGLPLPLPMEWHENLATELPPAINTEDLPLPLPSPANISHRADIOAL

PIPELINE

CHART KEY* = Top 5 Requests

= Increased Rotation(CD) = CD Airplay

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (46)

THEHARD REPORT REPORTS

KTCL FT. COLLINSP.D. JOHNSAYESM.D. CHARLIE WROBBELPH: 303-571-1232

UGHTADDSTHE CARS YOUDUKE/STRATOSPHR LPDUMPTRUCK NOWHEREEAGERTONES LPIT'S IMMATERIAL DRIVINGLYLE LOVETT LPMOJO NIXON ELVISTOM WAITS HANGWATER WALK LP

.

HEAVYtABC WHENCOLOURFIELD RUNNING

*THE CURE WHYTHRASHING DOVES IMBALANCEECHO/BUNNYMEN NEWTHE FIXX SCAREDY. FRESH FELLOW LP

*GRATEFUL DEAD TOUCHLOS LOBOS SETREPLACEMENTS LP

*THE SILENCERS PAINTEDTHE SMITHS LPSUZANNE VEGA LUKAWIRE TRAIN SHEX LP

MEDIUM10,000 MANIACS PEACEART OF NOISE DRAGNETBEAT FARMERS DARKBELOUIS SOME LETCRUZADOS BEDDUANE EDDY LP

FABULOUS TBIRDS STANDFAITH NO MORE WEJOHN HIATT THANK*JON ASTLEY JANERONDO ROCK LOVENEIL YOUNG LPTOM PETTY MEROGER WATERS SUNSETSTYLE COUNCIL HEAVENSTWISTED SISTER LPU2WIRE AHEADLIGHTNEW MODEL ARMY LPLA BAMBA ST LPTHE LPBRIANBEA BRARS IN LP

IMESCURIOSITY/CATMISFIT

' TDEAD MILKMEN LPFATAL FLOWERS LPGO-BETWEENS LPICICLE WORKS JANEJESUS/MARY CH APRIL

*STEVE JONES LPLOST BOYS ST PEOPLEMIGHTY LEMON DR OUT

LUCKYLIME 7MOODONMSIX

OTET PLPALISPAUL KELLY LPPLASTICLAND LPPAT METHENY LASTTACKHEAD 12"THIRD WORLD REGGAETONTOTIREZ TIREZ W SEXAKEKTHAT PETROL EMO BIG

KTCZ. MINNEAPOLISP.D. ALAN LAWSONM.D. JANE ROGGEPH: 612-339-0000MUSIC CALLS MON-FRI 9-5READY TUE AFTERNOON

MEDIUM ADDMARC JORDON INDEPENDENCEco*ck ROBIN JUSTCURIOUSITY/CAT FREELIGHT ADDSMARC JORDON CATCHMARC JORDON I CHINGco*ck ROBIN BIGGESTco*ck ROBIN MOMENTCHECKFIELD DISTANTCHECKFIELD SPRING

POWERJON ASTLEY JANECHRIS DANIELS WHENPETE BARDENS DREAMSROGER WATERS TIDEGRATEFUL DEAD PUSHHEAVYSWING OUT SISTER BREAKOUTDANNY WILSON DAVYSUZANNE VEGA SOLITUDEIMMAC. FOOLS TRAGEDYWARREN ZEVON CONSIDERCROWDED HOUSE SOMETHINGM. TOMLINSON HIGHWAYROGER DALTREY HEARTDAVID BOWIE JULIEDANNY WILSON PLANDAN FOGELBERG LONELY/WAYJOE WALSH TIMENEIL YOUNG INCA

MEDIUMM. CRENSHAW THISSWING OUT SISTER FOOLEDBRUCE co*ckBURN WAITING/STOLENP.KELLY DON'TM. TOMLINSONC. DANIELSGRATEFUL DEAD

WARREN ZEVONCOLOURFIELDFIRE TOWNLYLE LOVETTBEARSFLEETWOOD MACREPLACEMENTSJON BUTCHERC. BLONDEWENDY WALDMANJESSE YOUNGSILENCERSSUZANNE VEGAJON ASTLEY

UGHTDUANE EDDYTRUTHFIRE TOWNFLEETWOOD MACP. KELLYPAUL JANZ

BELIEVETRUTHWEST/BLACK/TOUCH/STEELTROUBLEMISS/CONFESSIONCARRYLEVELWAVEEVERYWHERESKYWAYGOODBYEMAKELIVINGERICALETTERGYPSYSUFFERING

LOSTEDGERAINLITTLESTORIESCRY

CHART KEY* = Top 5 Requests

= Increased Rotation(CD) = CD Airplay

Radio Reports...Monday & Tuesday10am - 7pm EST

KTKODALLASP.O. ANDY LOCKRIDGEM.D. REDBEARDPH: 214-528-5500CON: B -A -D -E

HEAVY*AEROSMADDSITH DUDE

MEMU2

UM ADDSSTREETS

*THE CARS YOULIGHT ADDSMELVIN JAMES WHYJOE.WALSH CAR

HEAVYTHE CULT WILDDEF LEPPARD

*DEF LEPPARD LOVEDEF LEPPARD WOMENDIO DREAMERFABULOUS TBIRDS NATURALLYGRATEFUL DEAD TOUCH

*GREAT WHITE ROCKHOOTERS JOHNNYJ.C. MELLENCAMP PAPER*JON ASTLEY JANELOVERBOY NOTORIOUSMOTLEY CRUE NAMEWHITESNAKE BREAK

MEDIUMBEAT FARMERS DARKTHE BRANDOS GETTYSBURGBRYAN ADAMS ONLYJON BUTCHER WISHESTHE CALL BEENCHARLIE DANIELS BOGGEDTHE CURE HEAVENTHE CURE KISSDEF LEPPARD ANIMALDEF LEPPARD ARMAGEDDONDEF LEPPARD GODSDEF LEPPARD HYSTERIADEF LEPPARD SHOOTDEF LEPPARD SUGARDEF LEPPARD TEARGLEN BURTNICK FOLLOWGRATEFUL DEAD HELLGUNS N' ROSES WELCOMESAMMY HAGAR BOYSHOOTERS SATELLITEINSIDERS GHOSTMOTLEY CRUE WILDOMAR/HOWLERS BORDERPAUL KELLY DARLINGROGER WATERS POWERSTHE SILENCERS PAINTEDLIGHT

MOE OE LR UFFNER WORLDDTOM KIMMEL DANCETNT STAR

KTYD SANTA BARBARAP.D. USS MOTTLAM.D. JANE ASHERPH: 805-967-4511CON: LARRY BRUCEMUSIC:MON AFTCALLS:THU-FRI -9- 5

HEAVY ADDSTHE CARSFARRENHEITSAMMY HAGAR

MEDIUM ADDSAEROSMITHLIGHT ADDSTHE CUREDIOMELVIN JAMES

POWERGRATEFUL DEAD

HEAVYBRYAN ADAMSDEF LEPPARD,DEF LEPPARD?GLEN BURTNICKGRATEFUL DEADGRATEFUL DEADSAMMY HAGARHOOTERSHOOTERSHOOTERS JOHNNYHOOTERS SATELLITEJ.C. MELLENCAMP PAPER (CD)?JON ASTLEY JANENEIL YOUNG' LONELYPAUL KELLY DARLINGWHITESNAKE HEREMEDIUMLA BAMBA ST BAMBABEAT FARMERS DARKBEV HILLS COP 2 SHAKE

?THE BRANDOS GETTYSBURGBRYAN ADAMS FIREJON BUTCHER WISHESCRUZADOS BEDTHE CULT WILDTHE FIXX SCAREDGREGG ALLMAN RUNNINGGREAT WHITE ROCK

_JOHNHEART HIATT THINGILIVING/DAY ST WHERERICHARD MARX SHOULDTOM PETTY MIXEDREPLACEMENTS ALEXROGER WATERS RADIOROGER WATERS SUNSETPATTY SMYTH ISN'TU2 STREETSJOE WALSH CARJOE WALSH MALIBUJOE WALSH RADIO

JULYY&T CONTAGIOUSWARREN ZEVON DETOX (CD)WARREN ZEVON EVEN

LIGHTBOSTON HOLLYANNDAVID BOWIE NEVERECHO/BUNNYMENJOE ELY LORDEUROPE CARRIE (CD)INSIDERS GHOSTLOVERBOY NOTORIOUSTHE SILENCERS PAINTEDSTEPPENWOLF HOLD

YOUBADHOME

DUDE

HEAVEN

WHYDREAMER

TOUCH

VICTIMANIMALWOMENFOLLOWHELLPUSHBOYSFIGHTINHARD

KUSF. SAN FRANCISCOP.D. TIM HYDEM.D. BILL MCLAUGHLINPH: 415-386-5873MUSIC: MON AFTCALLS: MON-FRI 9-5P

ADDSDUKES/STRATOSPHEARGENE LOVES JEZEBELPUBLIC IMAGETHELONIOUS MONSTERSHADOWS/TREESTALKING HEADSBOSTON GOES...THE CULTPASSION FODDERNICE STRONG ARM

HEAVYVIEW FROM HEREECHO/BUNNYMENPAUL KELLYLIME SPIDERSYELLOSONIC YOUTHSCREAMING BROCCOLILONELY/EYESORETHE CUREBLEACHED BLACKdB'sM. LEMON DROPS

(CD)

(CD)

(CD)

LP12"LPLP12"HEYLPWILD12"LP

LPLPLPLPLPLPLPLPLPLPLPLP

THATCHER/ACID LPNEW MODEL ARMY LPHEAD LPDANIELLE DAX LPTHAT/EMOTION LPX LPJAMES RAY LP'MIRACLE LEGION LPNEW ORDER LPTUXEDOMOON LPJESUS/MARY CHAIN APRILHOUSE OF LOVE LPNETTWERX COMP. LPDONNER PARTY LPWILD FLOWERS LPWILLIAM ORBIT LPUB40 LPNEON JUDGEMENT 12"KILLER BEES LPSILENCERS LPSIOUSXIE/BANSHEES SONGDEAD MILKMEN LP

KVRE SANTA ROSAP.D. BILL BOWKERM.D. SCOTT MURRAYPH: 707-544-5873MUSIC:TUE AFTCALLS:MON-FRI 9-10FROZEN REPORT

HEAVYLA BAMBA ST BAMBABRUCE co*ckBURN WAITINGCROWDED HOUSE WORLDCRUZADOS BEDFLEETWOOD MAC LITTLEGRATEFUL...DEAD LPJOHN HIATT LPTHE LONG RYDERS BADM. CRENSHAW EASYMASON RUFFNER LPTOM PETTY LIFESTAN CAMPBELL YEARSSUZANNE VEGA SOLITUDE

U2U2

WITHSPANISH

MEDIUM10,000 MANIACSBEAT FARMERSDAVID BOWIEBRYAN ADAMSJON BUTCHERTHE CALLTHE CURESTEVE EARLEFABULOUS THIRDSDAN FOGELBERGFIRE TOWNG. SATELLITESHEARTHOOTERSCHRIS ISAAK',RICHARD MARXALISON MOTETNEIL YOUNGROGER WATERSLITTLE STEVENJOE WALSHWENDY WALDMANXWARREN ZEVONLIGHTBACK/BEACH STBILL BRUFORDTHE BEARSTHE BEARSROGER DALTREYDUANE EDDYDANNY WILSONDYNATONESECHO/BUNNYMENJOE ELYFIGURES BEACHTHE FIXXMICHAEL FRANKSGO-BETWEENSIDEOLAICICLE WORKSJESSE C. YOUNGJON ASTLEYSTEVE JONESJUDE COLELUCKY 7

KWHLR'

ANQHQPIRDEP.D. CARTE BRAD EYM.D. KEVIN VARGASPH: 907-344-9622CON: AL PETERSONMUSIC:TUE AFTCALLS:MON-TUE 5- 9

POWER ADDSTHE CARSHEAVY ADDSAEROSMITHMEDIUM ADDSTHE CULTROGER DALTREYHEARTHOOTERSMELVIN JAMESPAUL KELLY

PWMR*DEF LEPPARDIGRATEFUL DEADSAMMY HAGARSAMMY HAGARILOVERBOYHEAVY?BRYAN ADAMSDEF LEPPARDDEF LEPPARDDEF LEPPARD*DEF LEPPARDDIOEUROPEGRATEFUL DEADGRATEFUL DEAD*GREAT WHITEHEARTJ.C. MELLENCAMP PAPERTOM PETTY MIXEDROGER WATERS SUNSETPATTY SMYTH ISN'TJOE WALSH CARWHITESNAKE ISMEDIUMBEAT FARMERS DARKDAVID BOWIE NEVER*FASTER puss*CAT CHANGEGLEN BURTNICK FOLLOWRICHARD MARX SHOULDSTARSHIP BABYLONTWISTED SISTER HOTURGENT TAKEWARREN ZEVON DETOXLIGHTFLEETWOOD MAC LITTLELOST BOYS ST SHADOWSMOTLEY CRUE WILD

PEACEDARKNEVERHEATWISHESWANNAWHYSATISFIEDSTANDSHECARRYMYTHALONEJOHNNYLSHOULDISLONGRADIOTRAILRADIOLIVINGJULYDETOX

PIPELINENORTHLPBRAZILLIANTAKE

PRAYERSHOUTLLORDSTARS

LSCAREDPLPLPLPHIGHWAYJANEMERCY

LLPIKE

KWIC -FM BEAUMONT

YOU

DUDE

WILDFIREGIRLSATELLITEWHYDARLING

(CD)

S33

HELLWOMEN

1BOYSHOME

E1NOTORIOUS

CD

VICTIMANIMALARMAGEDDONGODSTEARDREAMERCARRIEPUSHWESTROCKEASY

P.D. TED GARLANDM.D. TIM KELLEYPH: 409-842-2210MUSIC:TUE AFTCALLS:THU-MON 02- 4

HEAVY ADDSAEROSMITHOUTFIELDMEDIUM ADDSHEARTLIGHT ADDSTHE BRANDOSMELVIN JAMESTOM KIMMELWHITESNAKEYET

MAIN

WAIT

GETTYSBURGWHYDANCEISTEMPTATION

CDCDCDCDCDCDCDCDCDCDCDCD

CDCDCD

CD

CDCDCDCOCD

CDCD

CDCD

HEAVY38 SPECIAL BACKBEAT FARMERS DARK

?DAVID BOWIE NEVERBRYAN ADAMS VICTIM

*JON BUTCHER WISHESTHE CALL WANNACRUZADOS BED

*DEF LEPPARD WOMENGRATEFUL DEAD TOUCHGREAT WHITE ROCKSAMMY HAGAR BOYSSAMMY HAGAR HOME*HOOTERS JOHNNY!INSIDERS GHOSTJ.C. MELLENCAMP PAPERJON ASTLEY JANELOVERBOY NOTORIOUSNEIL YOUNG LONELY?TOM PETTY MIXEDROGER WATERS SUNSETJOE WALSH CARJOE WALSH FUNWHITESNAKE HEREMEDIUMtACE FREHLEY ROCKDAVID BOWIE BANGCROWDED HOUSE WORLDITHE CULT

HEAVENDEF

CURE HEAVENDEF LEPPARD ANIMAL (CD)DEF LEPPARD HYSTERIA (CD)

EUROPE CARRIEDREAMER

FABULOUS THIRDS SPELL?FLEETWOOD MAC LITTLE (CD)GRATEFUL DEAD HELLGRATEFUL DEAD PUSHSAMMY HAGAR EAGLESHOOTERS SATELLITEILIVING/DAY ST WHERERICHARD MARX SHOULDMOTLEY CRUE WILDTHE SILENCERS PAINTEDPATTY SMYTH ISN'TSTEPPENWOLF HOLDSUZANNE VEDA SOLITUDE

STREETS (CD)tWHITE LION WAITWARREN ZEVON DETOXLIGHTTHE BEARS FEARROGER DALTREY FIREDANNY LW ILSON LADRFASTER puss*CAT CHANGEGLEN BURTNICK FOLLOWGUNS N' ROSES WELCOMEHELIX WILD (CD)JOHN HIATT THINGTHE LONG RYDERS BADOMAR/HOWLERS MAN (CD)PETE HARDENS DREAMS

VITILKIpitErrivAllM.D. LARRY SNIDERPH: 206-323-3636CON: LARRY BRUCEMUSIC:TUE AFTCALLS:WED-FRI 2- 6

HEAVY ADDSTHE CARSMEDIUM ADDSBILLY IDOLTHE BRANDOSHEARTHOOTERS

HEAVYCRUZADOS

BEE MtCRUZADOS i

FABULOUS THIRDS SPELL?GRATEFUL DEAD HELLHEART WANT M3HOOTERS JOHNNY

*J.C. MELLENCAMP PAPER (CD)'RICHARD MARX SHOULDMR. MISTER SOMETHING?THE SILENCERS PAINTEDSLAMHOUND HUNTS CADILLAC

MEDIUMTIMESJOHN WAITE .

LA BAMBA ST BAMBABEAT FARMERS DARKDAVID BOWIE NEVER (CD)CUTTING CREW LOVE*GREAT WHITE ROCKINSIDERS GHOST SI:131

MASON RUFFNER RUNNIN' tC13iMELVIN JAMES WHYTOM PETTYROBERT CRAY MIR iggiPATTY SMYTH ISN'TU2 REDU2(CD)JOHN WAITE

STREETS

LreirivTHE SCAR ED

CD

BEACH ST PIPELINE

HEARTFIXXMASON RUFFNER RED

WHO

ROBIN TROWER PASSIONPRINCES TRUST MONEYU2 SPANISHX JULY

KYYS KANSAS CITYP.D. SCOTT JAMESONM.D. SKID ROADIEPH: 816-561-9102CON: B -A -D -EMUSIC:TUE AFTCALLS:MON-WED

HEAVY ADDS*AEROSMITHU2

MEDIUM ADDSTHE CARSFLEETWOOD MACGLEN.BURTNICKHOOTERSMELVIN JAMES

POWERDAVID BOWIE NEVERCRUZADOS BED (CD)FABULOUS THIRDS SPELLHOOTERS JOHNNY

*J.C. MELLENCAMP PAPER (CD)*JON ASTLEY JANE?TOM PETTY MIXEDROGER WATERS SUNSET (CD)HEAVY

}RICHARD MARX SHOULDMEDIUMBEAT FARMERS DARKTHE CALL INCHARLIE DANIELS BOGGEDDEF LEPPARD ANIMALDEF LEPPARD WOMENGRATEFUL DEAD HELL (CD)SAMMY HAGAR BOYSINSIDERS GHOSTLOVERBOY NOTORIOUSLIVING/DAY ST WHEREMR. MISTER SOMETHING (CD)*PETE BARDENS DREAMSPAUL KELLY DARLINGPAT METHENY LASTREPLACEMENTS ALEXROBERT VAUGHN JUSTICE (CD)SUZANNE VEGA SOLITUDEJOE WALSH CAR

YOU

MONYGETTYSBURGGIRL (CD)SATELLITE

WHETS M3YOULITTLEFOLLOW

(CD)

SATELLITE (CD)WHY

KZAM EUGENEP.D. TOM KRUMMPH: 503-741-1999MUSIC:TUE AFTCALLS:MON-FRI 11- 1

MEDIUM ADDSTHE CARS YOU

LIGHT ADDSD. MASON MUSICLYLE LOVETT WHYPETE WYLIE SINFUL

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (47)

THEREPORT REPORTS

HEAVYDAVID BOWIE LPDAN FOGELBERG LPGRATEFUL DEAD LPHEART LP

RICHOOT

HARDERS

MARX LPNEIL YOUNG LPTOM PETTY LP

LPSTARSHIP OVERWARREN ZEVON LPDWMTHE CALL WANNA (CD)co*ck ROBIN JUSTCRUZADOS SMALLCRUZADOS WORLD (CD)ROGER DALTREY FIREDUANE EDDY LPJOAN BAEZ JAMESJ.C. MELLENCAMP PAPERJESSE C. YOUNG ERICAPAUL KELLY LEAPSROGER WATERS RADIOSUZANNE VEGA SOLITUDEJOE WALSH CARLIGHTBACK/BEACH ST PIPELINEBEAT FARMERS DARKTHE CALL WALK

HOLJOE LY NELY

EAR LPLORD

ICICLEIX

ORKS JANEMOM. TOMLINSON LPPETE BARDENS DREAMS (CD)ROBERT VAUGHN LOVETHE SILENCERS CRYTHE SILENCERS PAINTEDSTEPPENWOLF HOLDWENDY WALDMAN DESTINED

KZAP SACRAMENTOP.D. TOM CALEM.D. BILL PRESCOTTPH: 916-925-3700CON: B-A-D-E/JEFF POLLACK

HEAVY ADDSTHE CARS YOUFLEETWOOD MAC LITTLE

MEDIUM ADDSAEROSMITHROGER DALTREYLOST BOYS STGREGG ROLIELIGHT ADDS'MELVIN JAMES WHYPETE WYLIE SINFUL (CD)

HEAVYBRYAN ADAMS VICTIMCRUZADOS BED}GRATEFUL DEAD HELLHOOTERS JOHNNYJ.C. MELLENCAMP PAPERTOM PETTY MIXEDWHITESNAKE HERE

MEDIUM/THE BEARSJON BUTCHERDEF LEPPARDGREGG ALLMANGREAT WHITESAMMY HAGARHEARTLOVERBOYLIVING/DAY STRICHARD MARXROGER WATERSSTARSHIPLIGHTBEAT FARMERSGLEN BURTNICKPETE BARDENSPAUL KELLYTHE SILENCERSTESLAWARREN ZEVON

FEARWISHESWOMENRUNNING

CD)ROCKBOYSWAIT (CD)NOTORIOUSWHERESHOULD (CD)SUNSETBABYLON (CD)

DARKFOLLOWDREAMSDARLINGPAINTEDROCKDETOX

KZEL EUGENEP.D. JIM TRAPPM.D. BILL ST. JAMESPH: 503-342-7096MUSIC:TUE AFTCALLS:MON-FRI 10-12

MEDIUM ADDSCUTTING CREW LOVECRUZADOS SMALLSAMMY HAGAR HOMELOVERBOY NOTORIOUSMELVIN JAMES WHYMR. MISTER SOMETHINGROYAL COURT.... CHANGEDLIGHT ADDSD TB'S HINKD.L. JONES BONNIEECHO/BUNNYMEN LIPSOUTFIELD AMERICA

HEAVY

THEBEAT

CALLFARMERS DARK

IN/CRUZADOS LASTTHE CURE HEAVENGLEN BURTNICK FOLLOWGRATEFUL DEAD HELLIGRATEFUL DEAD

DUDEFIRESHADOWSFIRE

BAMBASUMMERTIMEPIPELINEBANGNEVER

{THE BRANDOSCALLGETTYSBURGDAY

CRUZADOS BEDICRUZADOS ROADtECHO/BUNNYMEN NEWFABULOUS TBIRDS STAND

!GRATEFUL DEAD STONESGRATEFUL DEAD TOUCHJOHN HIATT THINGHOOTERS KARLALIONS & GHOSTS MARYLYLE LOVETT RESISTRICHARD MARX SHOULD!MASON RUFFNER FIGHTMASON RUFFNER WORLDOUTFIELD SINCE!PAUL CARRACK SHEDREPLACEMENTS ALEXROGER WATERS SUNSETROBERT VAUGHN JUSTICETHE SILENCERS OUGHTJOE WALSH CARLIGHTBACK/BEACH ST ABSOLUTEDAVE PERKINS YOUHURRAH RIVERSSIMPLE MINDS LOVESTARSHIP BABYLONSTEPPENWOLF HOLDIN VITRO SUFFERWALL OF VOODOO DO

SATELLITE}INSIDERS GHOSTN.C. MELLENCAMP PAPERLITTLE AMERICA WAYOUTFIELD HEARTTOM PETTY MIXEDPAUL KELLY DARLINGTHE SILENCERS PAINTEDPATTY SMYTH ISN'TtSUZANNE VEGA SOLITUDEARREN ZEVON DETOXDWMLA BAMBA STLA BAMBA ST!BACK/BEACH STDAVID BOWIEDAVID BOW

CHART KEY*. Top 5 Requests

= Increased Rotation(CD) = CD Airplay

Radio Reports...Monday & Tuesday10am - 7pm EST

(CD)

CD

KZEW DALLASM.D. SUM. HORNERPH: 214-748-9898CON: JON SINTON

HEAVY ADDSU2

MEDIUM ADDSAEROSMITHLA SAMBA STBRYAN ADAMSTHE CARSFABULOUS TBIRDSOMAR/HOWLERS

REMPAUL KELLY

HEAVY/LA BAMBA STFABULOUS TBIRDSGRATEFUL DEADGRATEFUL DEAD!GREAT WHITESAMMY HAGARHEARTJ.C. MELLENCAMPRICHARD MARXSTARSHIPJOHN WAITEWHITESNAKEMEDIUM38 SPECIALBEAT FARMERSBRYAN ADAMSJON BUTCHERCHARLIE DANIELSCRUZADOSDIOFLEETWOOD MACSAMMY HAGARHOOTERSJON ASTLEYSTEVE JONESLOVERBOYTOM PETTYROGER WATERSU2JOE WALSHJOE WALSHLIGHTINSIDERS

BULLET

DUDECOME

YOUONLY

NUMBERBORDER

DARLING

BAMBASPELLHELLTOUCHROCKGIVEWHOPAPERMEANOVER

HERETIMES

BACKDARKVICTIMWISHESBOGGED

DREAMERLITTLEBOYSJOHNNYJANEMERCYNOTORIOUSMIXED CDRADIO CDSTREETS CDCAR CDRADIO CD

CDCDCDCDCD

CD

CD

03(CD)

a(CD)

GHOST (CD)

KZ00 MISSOULAP.D. VERN ARGOPH: 406-728-5000MUSIC:MON AFTCALLS:MON-FRI 09- 5

HEAVY ADDSTHE CARS YOUMEDIUM ADDSAEROSMITH DUDEGRATEFUL DEAD HELL CDSAMMY HAGAR HOME CDREPLACEMENTS ALEX

POWER*DEF LEPPARD WOMEN(EUROPE CARRIEtFLEETWOOD MAC LITTLESAMMY HAGAR BOYSHOOTERS JOHNNYtJ.C. MELLENCAMP PAPERHEAVYIBRYAN ADAMS VICTIMCRUZADOS BED*GREAT WHITE ROCKJON ASTLEY JANE (CD)*LOST BOYS ST GOOD

/LOVERBOYNOTORIOUS

LIVING DAY ST WHERERICHARD MARX SHOULDTOM PETTY MIXEDtPAUL KELLY DARLINGtU2 SJOE WALSH CARWHITESNAKE HEREMEDIUM*LA BAMBA ST SAMBABEAT FARMERS DARKDAVID BOWIE NEVERJON BUTCHER WISHESCHARLIE DANIELS BOGGEDco*ck ROBIN JUSTCROWDED HOUSE WORLDDIO DREAMERFABULOUS TBIRDS SPELLGLEN BURTNICK FOLLOWMASON RUFFNER WORLD (CD)!MELVIN JAMES WHYMR. MISTER SOMETHINGOUTFIELD HEARTROGER WATERS SUNSETGREGG ROLIE HANDSPATTY SMYTH ISN'T (CD)STARSHIP BABYLONSUZANNE VEGA SOLITUDEURGENT TAKEPETE WYLIE SINFULWARREN ZEVON DETOXLIGHTTHE BRANDOS GETTYSBURGCUTTING CREW LOVE

laRR ALBUQUERQUEP.D. FRANK JAXONM.D. HUBBY DEANPH: 505-765-5400CON: JON SINTON

MEDIUM ADDS*AEROSMITHDAVID BOWIETHE CARSSAMMY HAGAR

LIGHT ADDSMOTLEY CRUEMELVIN JAMES

HEAVY.38 SPECIAL

(BRYAN ADAMSEUROPEGRATEFUL DEADSAMMY HAGARHEART.J.C. MELLENCAMPSTARSHIPWHITESNAKEMEDIUMLA BAMBA STCRUZADOSDEF LEPPARDDEF LEPPARDDANNY WILSONFABULOUS THIRDSFLEETWOOD MACGRATEFUL DEAD*GREAT WHITEHOOTERSJON ASTLEYRICHARD MARXMR. MISTERTOM PETTYROGER WATERS

PATTYSMYTH

2JOE WALSH

LIGHTJON BUTCHERINSIDERSLOVERBOYPETE HARDENSPAUL KELLYWARREN ZEVON

DUDE

YOUNEvERHOME

WILDWHY

BACKVICTIM (CD)CARRIETOUCHGIVEWHOPAPEROVERHERE (CD)

BAMBA (CD)BEDANIMALWOMENPRAYERSPELLLITTLEHELL

(CD)

ROCKJOHNNYJANESHOULD 03SOMETHINGMIXED (CD)SUNSETISN'TSCTREETSAR (CD)

WISHES (CD)GHOSTNOTORIOUSDREAMSDARLINGDETOX

MAAFINORCESTER/BOSTP.D. CYNDE SLATERM.D. RICK MACKENZIEPH: 617-752-5611CALLS:THU-FRI 2- 5

HEAVY ADDS*AEROSMITHMEDIUM ADDSTHE CARS

LIGHT ADDSDIO

DUDE

YOU

DREAMER

(CD)

HEAVY38 SPECIAL BACK*DEF LEPPARD WOMENGRATEFUL DEAD TOUCH

igiGREAT WHITEHOOTERS

ROCKJOHNNY

*J.C. MELLENCAMP PAPERLOST BOYS ST GOOD (CD)

*WHITESNAKE HERNOTOERIOUS

DAVID BOWIE BANGDAVIDNEVER

(CD)DAVID BOWIEBRYAN ADAMSJON BUTCHER

VICTIM CDWISHES

CHARLIE DANIELS BOGGED CDCROWDED HOUSE WORLDCRUZADOS BED

ANIMAL(CD)

DEF LEPPARDDEF LEPPARD SUGARFABULOUS THIRDS SPELLFABULOUS TBIRDS STANDFLEETWOOD MAC LITTLEFLEETWOOD MAC SEVEN (CD)GRATEFUL DEAD STONESSAMMY HAGAR BOYSSAMMY HAGAR GIVESAMMY HAGAR WHENHEARTHOOTERS SATELLITEJON ASTLEY (CD)MARILLION

JANE

RICHARD MARX MEAN (CD)RICHARD MARX SHOULDMASON RUFFNER WORLDMOTLEY CRUE GIRLSNEIL YOUNG LONELYOMAR/HOWLERS DANCINGOMAR/HOWLERS HARDOUTFIELD SINCETOM PETTY DAMAGETOM PETTY RUNAWAY CDROGER WATERS RADIO CDROGER WATERS SUNSET!THE SILENCERS PAINTEDPATTY SMYTH ISN'T

OVER(CD)

STARSHIPTOM KIMMEL FREEDOMU2 SPANISHU2 STREETS (CD)JOHN WAITE TIMESJOE WALSH CAR (CD)JOE WALSHLIGHTBEAT FARMERS DARKT WILHECULTFARRENHEIT BAD (CD)MELVIN JAMES WHYPAUL KELLY DARLINGTWISTED SISTER HOT

MDR SOUTHBENDP.D. GREGG RICHARDSM.D. SUE FREYPH: 616-683-5432CON: MIKE JONESMUSIC:TUE AFTCALLS:WED-FRI 8- 4

HEAVY ADDSTHE CARS YOUFLEETWOOD MAC LITTLE

MEDIUM ADDS*AEROSMITH DUDEFABULOUS THIRDS SPELLMELVIN JAMES WHYPAUL KELLY DARLING

HEAVY

LA BAMBA STBACK38 SPECIAL

CRUZADOSIBA 03

DEF LEPPARD ANIMAL

SAMMYHEART WHO

HAGAR BOYSCDCD

GRATEFUL DEAD TOUCH C

HOOTERS JOHNNYJ.C. MELLENCAMP PAPER (CD)LOVERBOY NOTORIOUSRICHARD MARX SHOULD (CD)

SOMETHINGU2 COUNTRY (CD)WHITESNAKE HERE (CD)

MEDIUMBEAT FARMERS DARK

*JON BUTCHERBRYAN ADAMS VICTIM

WISHES

CD

THE CALL WANNA CD

DAVID BOWIE NEVER

CHARLIE DANIELS BOGGEDROGER DALTREY FIREDEF LEPPARD WOMENDIO DREAMER

*GRATEFUL DEAD HELL

EUROPEFROZEN GHOST END

SATISFIED.CARRIE CD

CDCD

STEVE EARLE

GREAT WHITE ROCKHOOTERS SATELLITEINSIDERS GHOSTJON ASTLEY JANELOST BOYS ST GOOD (CD)LOST BOYS ST SHADOWSMASON RUFFNER WORLD (CD*OMAR/HOWLERS LEEOUTFIELD SINCETOM PETTY THINK (CD)*ROGER WATERS WHOGREGG ROLIE HANDSROBERT VAUGHN JUSTICETHE SILENCERS PAINTED

STARSHIP OVERCDPATTY SMYTH ISN'T

URGENT TAKEJOE WALSH CAR (CD)

VAPL APPLETONP.D. GARRETT HARTM.D. RICK PANNECKPH: 414-734-9226CON: AL PETERSONMUSIC:TUE MORCALLS:FRI-MON 8-12

HEAVY ADDSTHE CARS

MEDIUM ADDSHOOTERSU2WHITESNAKELIGHT ADDSAEROSMITHTHE BRANDOSPAUL KELLY

YOU

SATELLITE

ISSTREETS(CD)

DUDEGETTYSBURGDARLING

POWER/BRYAN ADAMS VICTIMEUROPE CARRIEGRATEFUL DEAD HELL (CD)tSAMMY HAGAR HOMEJ.C. MELLENCAMP PAPERHEAVYCRUZADOS BED (CD)DEF LEPPARD H

*DEF LEPPARD WOMEN*GREAT WHITE ROCK (CD)SAMMY HAGAR BOYS(RICHARD MARX SHOULDMR. MISTER SOMETHINGNEIL YOUNG LONELY (CD)TOM PETTY MIXEDPATTY SMYTH ISN'T (CD)STARSHIP BABYLONJOE WALSH CAR

MEDIUM38 SPECIAL BACKBEAT FARMERS DARK,DAVID BOWIE BANGNON BUTCHER WISHESHEART GIRLHEART W!INSIDERS GHOST

(CD)

LOVERBOY NOTORIOUSMOTLEY CRUE WILDREPLACEMENTS ALEXSTEPPENWOLF HOLD (CD)WARREN ZEVON BAD (CD)LIGHTTHE CALL WANNACHARLIE DANIELS BOGGEDDIO MERJOE ELY

DREAMERLORD

FLEETWOOD MAC MIDNIGHT (CD)LOST BOYS ST GOODROGER WATERS SUNSETURGENT TAKE

VAQX SYRACUSEP.D. SIMON JEFFRIESM.D. LORRAINE RAPPPH: 315-472-0200CON: AL PETERSONMUSIC:TUE AFTCALLS:WED-FRI 03- 5

!RICHARD MARXTOM PETTYROGER WATERSSTARSHIPU2*WHITESNAKEMEDIUMJON BUTCHER WISHESROGER DALTREY FIREDIO DREAMERFABULOUS TBIRDS SPELLHEART WHOHOOTERS HARDLIVING/DAY ST WHEREMARILLION SUGARMOTLEY CRUE WILDNEIL YOUNG LONELYPETE HARDENS DREAMSGREGG ROLIE HANDSSTARSHIP BABYLONtSTEPPENWOLF HOLDU2JOE WALSH CARWARREN ZEVON DETOXLIGHTBEAT FARMERS DARKTHE CULT WILDINSIDERS GHOSTMASON RUFFNER WORLDMELVIN JAMES WHYPAUL JANZ ONETESLA ROCKURGENT TAKE

HEAVY ADDSAEROSMITH DUDETHE CARS YOU

MEDIUM ADDSDEF LEPPARD ANIMALMR. MISTER SOMETHINGLIGHT ADDSTHE BRANDOSEUROPELOST BOYS STTNY&T

HEAVYBRYAN ADAMS VICTIMCRUZADOS BED*DEF LEPPARD WOMEN!GLEN BURTNICK FOLLOWGRATEFUL DEAD HELLGREAT WHITE ROCKSAMMY HAGAR BOYSJ.C. MELLENCAMP PAPERLOST BOYS ST GOOD

NOTORIOUSSHOULDMIXEDSUNSETOVERSTREETSHERE

GETTYSBURGCARRIESHADOWS

TEMPTATION

VBAB LONG ISLANDP.D. BOB BUCHMANNM.D. RALPH TORTORAPH: 516-587-1023

HEAVY ADDSTHE CARSMEDIUM ADDSAEROSMITHBILLY IDOLINSIDERSLOVERBOYMELVIN JAMESOMAR/HOWLERSTNT

YOU

DUDE (CD)MONYGHOST (CD)NOTORIOUSWHYMANSTAR (CD)

HEAVYLA BAMBA ST SAMBACRUZADOS BEDTHE CURE WHYDEF LEPPARD WOMEN/DANNY WILSON PRAYEREUROPE CARRIEGRATEFUL DEAD TOUCHSAMMY HAGAR GIVEHEART WHOJ.C. MELLENCAMP PAPERRICHARD MARX MEANSTARSHIP OVERSUZANNE VEGA' LUKA*WHITESNAKE HEREMEDIUM38 SPECIAL BACKLA BAMBA ST COMELA BAMBA ST SUMMERTIMEBRYAN ADAMS VICTIMCHARLIE DANIELS BOGGEDCROWDED HOUSE WORLDDEF LEPPARD ARMAGEDDONDEF LEPPARD SUGARDIO DRECHO/BUNNYMEN NEWELTON JOHN TINYFASTER puss*CAT CHANGE

GRATEFUL DEADRED

GRATEFUL DEAD PUSH*GREAT WHITE ROCK*SAMMY HAGAR BOYS

GHOOTERS JOHNNYHOOTERS SATELLITELOST BOYS ST GOODLIVING/DAY ST WHEREMOTLEY CRUE WILDMR. MISTER SOMETHINGJEFF PARIS SATURDAYPAUL KELLY DARLINGROGER WATERS RADIOROGER WATERS SUNSETSIMPLE MINDS FORGETPATTY SMYTH ISN'TSQUEEZE HOURSUZANNE VEGA SOLITUDESTEVE WINWOOD BACKTWISTED SISTER HOTU2U2 FOUNDRYU2WHITESNAKE I

TSRIP

WARREN ZEVON DETOX

WBCN. BOSTONP.D. OEDIPUSM.D. CARTER ALANPH: (617) 266-1111

ADDS:AEROSMITH DUDESQUEEZE HOURGLASSLOVERBOY NOTORIOUSCHARLIE DANIELS BOGGEDINSIDERS GHOST

1 U22 RICHARD MARX3 LOS LOBOS4 JON ASTLEY5 SIMPLE MINDS6 PAUL SIMON7 WHITESNAKE8 OUTFIELD9 THE CURE10 SUZANNE VEGA11 FAITH NO MORE12 GREAT WHITE13 DAVID BOWIE14 HOOTERS15 ROGER WATERS16 STARSHIP17 WARREN ZEVON

SPANISHMEANLA BAMBAJANEPROMISEDDIAMONDSHERESINCEHEAVENSOLITUDECAREROCKNEVERJOHNNYSUNSETOVERMONKEY

CDCDCDCDCDCDCDCDCDCDCDCD

CD

CDCDCD

CDCDCD

CD

CD

CD

CD

CD

CDCD

CDCDCD

CDCD

CDCD

CDCDCDCDCD

CDCD

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (48)

THEHARD REPORT REPORTS

CONTINUED

18 MASON RUFFNER WORLD19 HUEY LEWIS DOING20 GRATEFUL DEAD HELL21 CROWDED HOUSE WORLD22 PRETENDERS WHERE23 FAB. T -BIRDS STAND24 FLEETWOOD MAC LITTLE25 MARILLION INCOMMUNICADO26 THE CALL WANNA27 X FOURTH28 CULT WILD29 JOHN COUGAR MELLENCAMP PAPER30 JOHN HIATT THANK31 ECHO/BUNNYMEN NEW32 BEAT FARMERS DARK33 GARY MOORE OVER34 REPLACEMENTS ALEX35 FIRE TOWN TORCH36 ENVY SIN37 JON BUTCHER WISHES38 THE CARS YOU39 AIMEE MANN SIGN40 STEVIE RAY/DICK DALE PIPELINE41 DANNY WILSON MARY42 PAUL KELLY DARLING43 DEF LEPPARD ANIMAL44 TWISTED SISTER HOT45 FATBOYS WIPE46 ROGER DALTREY HEARTS47 KEEL CHERRY48 THE BRANDOS GETTYBURG49 TNT EVERYONE'S

ALSO ONSAMMY HAGARJOE ELY10,000 MANIACSBRYAN ADAMSDIOOMAR/HOWLERSCRUZADOSGUNS N ROSESPETE WYLIEGLEN BURTNICKMELVIN JAMES

VOLM LEWISTONP.D. JOSE DIAZM.D. ROBIN MATHIEUPH: 207-783-2065CON: B -A -D -E

MUSIC:TUE AFTCALLS:WED-THU 3- 5

HEAVY ADDSAEROSMITH

MEDIUM ADDSCUTTING CREWDEF LEPPARDMELVIN JAMESMR. MISTER

HEAVY38 SPECIAL

*LA BAMBA STTHE CARSDEF LEPPARDIGRATEFUL DEADGRATEFUL

*GREAT WHITEHOOTERSJ.C. MELLENCAMPJON ASTLEYSTARSHIPU2WHITESNAKEMEDIUMTHE BEARSBEAT FARMERSDAVID BOWIEBRYAN ADAMSJON BUTCHERCHARLIE DANIELSCROWDED HOUSECRUZADOSTHE CULTSHE CURE'DEF LEPPARDDIOEUROPEFABULOUS TBIRDSGRATEFUL DEADSAMMY HAGARHEARTINSIDERS

*LOVERBOYRICHARD MARXMOTLEY CRUEOMAR/HOWLERSOUTFIELDPETE BARDENSTOM PETTYPAUL KELLYROGER WATERS*SCOTT FOLSOMTHE SILENCERSPATTY SMYTHSTEPPENWOLFSUZANNE VEGATWISTED SISTERU2WARREN ZEVON

DUDE

LOVE

HYSTERIAWSOMETHING

BAMBAYOUWOMENHELLTOUCHROCK

JANEPAPER

OVERSTREETSHERE

Mi

CD1CD

(CD)

FEARDKNEVERVICTIMWBOGGEDISHES

WORLDBED CD

HEAVENCD CDANIMALDREAMERCARRIESPELLWESTBOYSWHO (CD)GHOSTNOTORIOUSSHOULDWILDMANSINCEDREAMS (CD)MIXEDDARLINGSUNSETLISTENPAINTEDISN'THOLDSOLITUDEHOTBULLET (CD)DETOX

NBNY BUFFALOM.D. ADAM LANGLEYPH: 716-878-3080MUSIC:MON EVECALLS:MON-TUE 11- 2

LIGHT ADDSBLACK BRITAIN LPBUCKWHEAT ZYDE. LPDB'S LPIT'S IMMATERIAL DRIVINGSKINNY PUPPY LPTOM WAITS HANG

HEAVYt10,000 MANIACS LPILONELY/EYESORE LPBLEACHED BLACK LPTHE CALL LPTHE MILKMEN LPDEAD MILKMEN LPECHO/BUNNYMEN LPIJESUS/MARY CH HAPPYMIGHTY LEMON DR LPLIME SPIDERS LPPAUL KELLY LPPLASTICLAND LPTHAT PETROL EMO LPITOM VERLAINE LP

MEDIUMLP

B 'S WINEW52 MODEL ARMY LPGB.A.D. 12BALANCING ACT LP"BEAT FARMERS DARKVARIATIONS II LPGO-BETWEENS LPICICLE WORKS LPMOOD SIXNITZER EBB LPNEW ORDER LP

'PEE WEE HERMAN SURFINISCRAM LPTHE SILENCERS LPSONIC YOUTH LPTHE SOUND LP

I

TSOL LPTOASTERS

LP

WESTWORLD 12"LIGHTFOLK DEVILS 12"

LAIBATERTCHOSH PLPPE

ROYAL COURT.... CHANGEDSWIMMING/Q'S EPTHELONIOUS MONS LPANTHRAX LAWU840 LPWILD FLOWERS LP

NBRU PROVIDENCEP.D. KURT HIRSCHM.D. ALISON STEWARTPH: 401-272-9550CON: B -A -D -EMUSIC:TUE AFTCALLS:TUE 2- 5

HEAVY ADDSTHE CARS YOUMEDIUM ADDSTHE BRANDOS GETTYSBURGSQUEEZE HOUR

HEAVYBOWIE NEVER

*JONDAVID BUTCHER WISHESCROWDED HOUSE WORLDGRATEFUL DEAD HELL?HOOTERS SATELLITEJ.C. MELLENCAMP PAPERLIVING/DAY ST WHERETOM PETTY MIXED (CD)U2 STREETS

MEDIUMBEAT FARMERS DARKBRYAN ADAMS VICTIMTHE CULT WILD*THE CURE HEAVEN (CD)FABULOUS THIRDS SPELLFABULOUS THIRDS STANDFLEETWOOD MAC LITTLEJOHN HIATT THINGINSIDERS GHOSTRICHARD MARX SHOULDMR. MISTER SOMETHINGOMAR/HOWLERS DANCINGPAUL KELLY DARLINGROGER WATERS SUNSETTHE SILENCERS PAINTEDSUZANNE VEGA EYESUZANNE VEGA SOLITUDE (CD)JOE WALSH CARWARREN ZEVON DETOXLIGHTLA BAMBA ST BAMBACRUZADOS BED (CD)STEVE EARLE SATISFIED

*ECHO/BUNNYMEN NEWGRATEFUL DEAD STONES

*GRATEFUL DEAD TOUCH (CD)GRATEFUL DEAD WESTHOOTERS JOHNNYJON ASTLEY JANE (CD)LOST BOYS ST GOODREPLACEMENTS ALEXSTEPPENWOLF HOLD

VeYR BUFFALOP.D. MIKE BENSSONM.D. CAROLYN WESSELPH: 716-852-9297CON: DAVE LOGAN

HEAVY ADDS*U2MEDIUM ADDS

STREETS

AEROSMITH DUDETHE CARS YOUGLEN BURTNICK FOLLOWRICHARD MARX SHOULDMELVIN JAMES WHYGREGG ROLIE FIREWHITESNAKE ISYST TEMPTATION

HEAVY*DAVID BOWIEBRYAN ADAMS*CROWDED HOUSE

/CRUZADOSGRATEFUL DEADGREAT WHITE?SAMMY HAGARHOOTERSR WATERS

NEVERVICTIMWORLD M3BEDHELLROCK

(CD)

JOHNNYSUNSET (CD)

BEAT FARMERS DARKTHE BRANDOS GETTYSBURGBRYAN ADAMS FIRE (CD)CHARLIE DANIELS BOGGED

DIOTHE

DREAMERCULT WILDMER (CD)

EUROPE CARRIEFABULOUS TBIRDS COMMONFABULOUS TBIRDS SPELLFLEETWOOD MAC LITTLEFLEETWOOD MAC MIDNIGHT (CD)FROZEN GHOST PROMISESGRATEFUL DEAD PUSH (CD)GRATEFUL DEAD TOUCHGRATEFUL DEAD WEST (CD)SAMMY HAGAR HOMEHEART TOUGH

S1,3;HEART WHOJOHN HIATT THANKJOHN HIATT THINGHOOTERS SATELLITE 03INSIDERS GHOSTJON ASTLEY JANE (CD)LOVERBOY NOTORIOUSLIVING/DAY ST WHEREMASON RUFFNER WORLDMR. MISTER SOMETHINGOZZY OSBOURNE CRAZY CDTOM PETTY MIXED CDTOM PETTY THINK CDPAUL KELLY DARLINGROGER WATERS WHO (CD)THE SILENCERS PAINTEDPATTY SMYTH ISN'TTWISTED SISTER HOTJOE WALSH CAR (CD)WARREN ZEVON DETOX

MCC -FM HARTFORDP.D. HARVE ALANPH: 203-233-4426

HEAVY ADDSTHE YOUFLEETWOCARSOD MAC LITTLE

MEDIUM ADDSAEROSMITH DUDECUTTING CREW LOVELIGHT ADDSFASTER puss*CAT CHANGEMELVIN JAMES WHY

POWERLA BAMBA ST BAMBA (CD)GRATEFUL DEAD TOUCH (CD)?HOOTERS JOHNNYJ.C. MELLENCAMP PAPERWHITESNAKE HERE (CD)

HEAVYBRYAN ADAMS VICTIMDEF LEPPARD WOMENDANNY WILSON PRAYER CDGREAT WHITE ROCK CDJON ASTLEY JANE CDLOST BOYS ST GOOD CDRICHARD MARX SHOULD CDOUTFIELD SINCE CDISUZANNE VEGA SOLITUDE CDU2 STREETS

MEDIUMBEAT FARMERS DARK (CD)DAVID BOWIE NEVERCHARLIE DANIELS BOGGEDCROWDED HOUSE WORLD (CD)THE CURE HEAVENDEF LEPPARD ANIMALDEF LEPPARD ARMAGEDDONGRATEFUL DEAD HELLSAMMY HAGAR BOYS 03HEART WHOINSIDERS GHOSTLOVERBOY NOTORIOUSLIVING/DAY ST WHERE

MARILLION INCOMMUNMR. MISTER SOMETHINGTOM PETTY MIXEDPAUL KELLY DARLINGROGER WATERS SUNSETTHE SILENCERS PAINTEDSTEPPENWOLF HOLDJOE WALSH CARLIGHT

EUROPE CDRARRIEEAMER

GLEN BURTNICK FOLLOW

WCDB. ALBANYM.D. JOSH ROSENTHALASST: KEVIN BYRNEPH: 518-442-5262MUSIC: MON AFT

ADDSTHE SOUNDBLACK BRITAINDB'SWILD FLOWERSPASSION FODDERJOAN BAEZJOHN ADAMSCURIOSITY/CATBANANARAMAMIRACLE LEGION

HEAVYDEAD MILKMENWILD MAMMOTHS10.000 MANIACSDEAD KENNEDYSBUCKWHEAT ZYDECOJANE'S ADDICITONLIME SPIDERSECHO/BUNNYMENNICE STRONG ARMTOO MUCH JOYLEMON HEADSWATER WALK

HANDLPLPLPLPLPLPLPLPLP

LPLPLPLPLPLPLPLPLPLPLPLP

THELONIOUS MONSTER LPPAUL KELLY LPKING KURT LPSUSAM MARSHALL LPSTEPFORD HUSBANDS LPPLASTICLAND LP

MEDIUMSILCENERSMOOD SIXENIGMA VARIATIONSKILLER BEESLUCKY SEVENDUANE EDDYTIREZ TIREZBEAT FARMERSQUEEN IDASCREAMING TREESBINKY PHILIPSWILLIAM ORBITBOYDYO BOYSWINDBREAKERSSURF MC'SPHIL GNARLYGBHSIMPLE MINDslu*tHER ALISONFRENCH, FRITH...BIG BLACKDENVER MEXICANS

NCKW NEW ORLEANSP.D. BOBBY RENOM.D. AL NASSERPH: 504-535-2424

(CD)

CD

(CD)

LPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPHEADACHELP

LIGHT ADDSLIVING/DAY ST WHERE

HEAVY38 SPECIAL BACKFLEETWOOD MAC FAMILYFLEETWOOD MAC LITTLEGRATEFUL DEAD HELLGRATEFUL DEAD PUSHGRATEFUL DEAD TOUCHGREAT WHITE ROCKSAMMY HAGAR BOYSHOOTERS JOHNNYJON ASTLEY JANELOST BOYS ST GOODSTARSHIP BABYLONJOHN WAITE TIMESJOE WALSH CARJOE WALSH GUMWHITESNAKE HEREWARREN ZEVON DETOXMEDIUMLA BAMBA ST BAMBACHARLIE DANIELS BOGGEDCRUZADOS BEDDEF LEPPARD WOMENDIOFABULOUS TBIRDS STANDHANK WILLIAMS BOOGIE

HEARTHEART ALONE

WHOIJ.C. MELLENCAMP PAPEROMAR/HOWLERS MANTOM PETTY MIXEDROGER WATERS SUNSETSTEPPENWOLF HOLDTWISTED

TSISTER HOT

URGENT AKELIGHT10,000 MANIACS PEACEBEAT FARMERS DARKJOE LORDFIREELY TOWN RAINGLEN BURTNICK FOLLOWINSIDERS GHOSTLOVERBOY NOTORIOUSMR. MISTER SOMETHINGROBERT VAUGHN JUSTICESUZANNE VEGA SOLITUDE

VCMF ROCHESTERP.D. STAN MAINM.D. DAVE KANE/APDPH: 716-262-4330MUSIC:TUE AFTCALLS:MON 2- 4

MEDIUM ADDSAEROSMITHTHE CARSLIGHT ADDSGLEN BURTNICKHOOTERSLOVERBOYMELVIN JAMES

HEAVYBRYAN ADAMSGRATEFUL DEADSAMMY HAGARtSAMMY HAGARHEARTOUTFIELDOUTFIELDTOM PETTYJOHN WAITE*WHITESNAKEMEDIUM38 SPECIALCROWDED HOUSECRUZADOS

DUDEYOU

FOLLOWSATELLITENOTORIOUSWHY

(CD)

HEARTS

IWHOGIVER CDSINCETARGET fgTIMESRUNAWAY

HERE(CD)

BACKSOMETHING

(CD)

BED (CD)

*DEF LEPPARD LOVEFLEETWOOD MAC MIDNIGHTGRATEFUL DEAD HELLG. SATELLITES MYTH*GREAT WHITE ROCKHUEY LEWIS NEWS DOINJ.C. MELLENCAMP PAPER*LOST BOYS ST SHADOWS?RICHARD MARX SHOULDTOM KIMMEL FREEDOMJOE WALSH CARLIGHT*EUROPE CARRIEINSIDERS GHOSTPATTY SMYTH ISN'TWETTON/MANZARA KEEP

MINA DOVERP.D. MIKE BOYLEPH: 201-328-1055

MEDIUM ADDSAEROSMITHTHE CARS

LIGHT ADDSYBT

HEAVY38.SPECIAL BACKLA BAMBA ST BAMBABRYAN ADAMS VICTIMCRUZADOS BEDDEF LEPPARD WOMENFABULOUS TBIRDS SPELLFLEETWOOD MAC MIDNIGHTGLEN BURTNICK FOLLOWGRATEFUL DEAD TOUCHGREAT WHITE ROCKSAMMY HAGAR BOYS

SI93

piCD

(CD)

(CD)

(CD)

DUDE (CD)YOU

TEMPTATION (CD)

HOOTERS JOHNNYJON ASTLEY JANELOST BOYS ST GOODNEIL YOUNG LONELYTOM PETTY MIXEDROGER WATERS SUNSETU2 STREETSJOE WALSH CAR

MEDIUMBEAT FARMERS DARK CDDAVID BOWIE NEVER CDJON BUTCHER WISHES CDTHE CALL WANNA CDCHARLIE DANIELS BOGGED CDCROWDED HOUSE WORLD CDTHE CURE HEAVEN CDROGER DALTREY FIRE CDDIO DREAMER CDEUROPE CARRIE CDTHE FIXX RED CDJOHN HIATT THING CDINSIDERS GHOST CDJ.C. MELLENCAMP PAPER CDLOVERBOY NOTORIOUSLIVING/DAY ST WHEREMARILLION SUGARRICHARD MARX SHOULDMOTLEY CRUE WILDMR. MISTER SOMETHING

(CD)CDCD

OMAR/HOWLERS MANOUTFIELD SINCE CDPETE BARDENS DREAMS CDPAUL KELLY DARLING CDREPLACEMENTS ALEX CDTHE SILENCERS PAINTED CDPATTY SMYTH ISN'T CDSTARSHIP OVER CDSUZANNE VEGA SOLITUDE CDTOM KIMMEL FREEDOM CDTWISTED SISTER HOT CDJOHN WAITE TIMES CDWARREN ZEVON MONKEYLIGHTTHE BEARS FEAR CDTHE BRANDOS GETTYSBURGco*ck ROBIN JUST CDTHE CULT WILD CDECHO/BUNNYMEN NEWICICLE WORKS JANEMELVIN JAMES WHY

MDIZIORLANDP.D. RAD ME iCKPH: 305-645-1802CON: JEFF POLLACK/B-A-D-EMUSIC:TUE AFTCALLS:MON 10- 4

HEAVY ADDS*AEROSMITH DUDETHE CARS YOU

MEDIUM ADDSFLEETWOOD MACGRATEFUL DEADLOVERBOYMR. MISTERWHITESNAKELIGHT ADDSMELVIN JAMES WHYOMAR/HOWLERS MAN

HEAVY'BRYAN ADAMS VICTIMDEF LEPPARD WOMEN

/GRATEFUL

DEAD HELLGREAT WHITE ROCKJ.C. MELLENCAMP PAPER!JON ASTLEY JANERICHARD MARX SHOULDTOM PETTY MIXEDtROGER WATERS SUNSETU2 STREETSMEDIUMBEAT FARMERS DARKDAVID BOWIE NEVERCROWDED HOUSE WORLDCRUZADOS BEDDEF LEPPARD ANIMALDIO DREAMERDANNY WILSON PRAYEREUROPE CARRIEFABULOUS TBIRDS SPELLGLEN BURTNICK FOLLOWSAMMY HAGAR BOYSSAMMY HAGAR HOMEHOOTERS JOHNNYINSIDERS GHOST

?PETE BARDENS DREAMSSUZANNE VEGA SOLITUDEJOE WALSH CAR

LITTLEPUSHNOTORIOUSSOMETHINGIS

WDVE PITTSBURGHP.D. HERSCHELM.D. A. ALFONSI/APDPH: 412-937-1441CON: B -A -D -EMUSIC:TUE MORCALLS:MON-FRI 9- 5

HEAVY ADDS*AEROSMITHSTARSHIPWHITESNAKE

MEDIUM ADDSTHE CARSTHE CULT

DUDEBABYLONI

WILD

CDCDCDCD

(CD)

CD

(CD)

CD

(CD)

iSE3

M3

03

CDCDCDCDCDCDCDCDCDCD

CDCDCDCDCDCDCDCDCDCD

CDCD

HEAVYBRYAN ADAMS HEARTSBRYAN ADAMS HEATBRYAN ADAMS VICTIMDEF LEPPARD ANIMAL*DEF LEPPARD EXCITABLEDEF LEPPARD SUGARDEF LEPPARD WOMENGRATEFUL DEAD HELL}GRATEFUL DEAD TOUCHGRATEFUL DEAD WESTSAMMY HAGAR BOYSSAMMY HAGAR GIVESAMMY HAGAR HOMEHOOTERS JOHNNYHOOTERS SATELLITEJ.C. MELLENCAMP PAPERLOST BOYS ST GOODOUTFIELD SINCESTARSHIP OVERU2 BULLETU2U2 FOUNDRYU2 STREETS

*W2 WITHHITESNAKE HERE

August 21, 1987

M3

S[33

(CD)

(CD)

CD

(CD)

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (49)

THE REPORTSMEDIUM38 SPECIALLA BARBA STBEV HILLS COP 2CHARLIE DANIELSCROWDED HOUSECRUZADOSROGER DALTREY*DIOFABULOUS TBIRDSGLEN BURTNICKGENESISGREGG ALLMAN*GREAT WHITE*HEARTHOOTERSINSIDERSJON ASTLEYLOVERBOYLIVING/DAY STRICHARD MARXRICHARD MARXTOM PETTYPAUL KELLYPATTY SMYTHSTEPPENWOLFTWISTED SISTER

WEN CINCINNATI

BACKBARBASHAKEBOGGEDSOMETHING (CD)BEDFIRE (CD)DREAMERSPELL

plFOLLOWDEEPANYTHINGROCK CDALONE CDGRAVEYARDGHOSTJANENOTORIOUSWHEREMEAN (CD)

SHOULDDARLINGISN'T

HOTHOLD

P.D. TOM OWENSM.D. TONY TOLLIVERPH: 513-871-8500MUSIC:TUE MORCALLS:TUE-THU 2- 5

HEAVY ADDSTHE CARS YOUDISORDERLIES ST EDGE

MEDIUM ADDSAEROSMITH DUDE

POWER*DEF LEPPARDGRATEFUL DEAD*J.C. MELLENCAMPRICHARD MARXITOM PETTYU2!JOHN WAITEWHITESNAKEHEAVYLA SAMBA STCRUZADOSGRATEFUL DEADHEARTLOVERBOYRICHARD MARXTOM PETTYPAUL KELLYTHE SILENCERSU2JOE WALSH

MEDIUMBRYAN ADAMSROGER DALTREYDEF LEPPARDGLEN BURTNICKGREAT WHITESAMMY HAGARINSIDERSSTARSHIPU2LIGHT38 SPECIALDEF LEPPARDHEARTHOOTERSLOST BOYS STNEIL YOUNG

TOUCHHYSTERIAPAPEMEANRDAMAGE CDFOUND CDTIMESHERE CD

BADS (CD)HELLNOTORIOUS (CD)SHOULDMIXED (CD)DARLINGPAINTEDSPANISHCAR

VICTIMFIREGODSFOLLOWROCKWHAT (CD)GHOST

BULLET (CD)OVER

BACKWOMENEASY (CD)JOHNNYGOOD (CD)LONELY (CD)

NEGR MEMPHISP.D. TIM SPENCERM.D. KELLY CRUISEPH: 901-578-1103CON: GEORGE WILLIAMSMUSIC:MON AFTCALLS:FRI-MON 11- 2

HEAVY ADDSAEROSMITH DUDEUGHTADDSTHE CARS YOU

POWERJONHEAVY ASTLEY JANE

38 SPECIAL BACKLA BARBA ST BAMBADEF LEPPARD WOMEN?GRATEFUL DEAD TOUCH (CD)HOOTERS JOHNNY*J.C. MELLENCAMP PAPERWHITESNAKE HERE (CD)EMUMMIBEAT FARMERS DARKBRYAN ADAMS VICTIMJON BUTCHER WISHESCRUZADOS BED 233DEF LEPPARD ANIMAL

*DEF LEPPARD EXCITABLEGRATEFUL DEAD HELL CDGREAT WHITE ROCK CDSAMMY HAGAR BOYS CDINSIDERS GHOSTLOVERBOY NOTORIOUSRICHARD MARX SHOULDTOM PETTY MIXEDROGER WATERS SUNSETPATTY SMYTH ISN'TU2 STREETSJOE WALSH CAR (CD)LIGHTCHARLIE DANIELS BOGGEDCROWDED HOUSE WORLDDIO DREAMERFABULOUS TBIRDS SPELLMOTLEY CRUE WILD (CD)GREGG ROLIE HANDSTHE SILENCERS PAINTEDTOMURGENTAKEKIMMEL

TDANCE

NEM MANCHESTERP.D. ELLEN MCKINNONM.D. HOWARD GLASSMANPH: 802-362-4800

MEDIUM ADDS

THEAEROSMCARS

YITH DOUUDE

DB'S CHANGEDB'S LIEDUMPTRUCK NOWHEREIT'S IMMATERIAL DRIVINGSTEPPENWOLF LIFETOM WAITS HANGWILD FLOWERS KINGDOMLIGHT ADDS

NEWMOJO

ORDER LNIXON ELVIS

HEAVY10,000 MANIACS LPBACK/BEACH ST LPTHE BE

ZADOSAR LPSCRUGRATEFUL DEAD LPHOOTERS LPINSIDERS GHOSTJ.C. MELLENCAMP PAPER

PAULLIVIN

KELLY LG/DAY

ST WHERE

PAT METHENY LASTROGER WATERS LPSIMPLE MINDS LPUB40 LPWARREN ZEVON LPMEDIUM10,000 MANIACS JACK10,000 MANIACS PEACELA BARBA ST LPBEAT FARMERS DARKBEAT FARMERS LPBINKY PHILLIPS LPTHE CALL LPTHE CURE LPDAVE PERKINS YOUECHO/BUNNYMEN LPJOE ELY LPFABULOUS TBIRDS LPFIRE TOWN LP

GO-BETWEENS LPPL

JOHNHEGE HIATT LPICICLE WORKS LPJON ASTLEY LPLOST BOYS ST LPLOVERBOY NOTORIOUSLUCKY

LO7VETT LP

LPLYLEMASOODN

SIX IRUFFNER LP

MONEIGHBORHOODS LPNEIL YOUNG LPOMAR/HOWLERS LPREPLACEMENTS LPROBERT VAUGHN LPTHE SILENCERS LPTHIRD WORLD LPTSOL NAMETOM VERLAINE LPU2 LPU2PETE WYLIE SINFULX LP

NFNX BOSTONP.D. MICHAEL BRIGHTM.D. BRUCE MCDONALDPH: 617-595-6200MUSIC:FRI AFTCALLS:MON-WED 12- 6

HEAVY ADDSECHO/BUNNYMEN LIPSMEINUMI ADDS

THK E/CARRATOSPHR VANISHINGLIME SPIDERS ROOM

LIGHTUB40

ADDSLP

DUMPTRUCK NOWHEREMOJO NIXON ELVISTOM WAITS HANG

HEAVYTHE CALL LPTHE CURE BEAUTIFUL

*THE CURE HEAVEN

*DEARE HD MILKMEN INSTANT

*ECHO/BUNNYMEN NEWECHO/BUNNYMEN OVERGENE LOVES JEZ SUSPICIONIT'S IMMATERIAL DRIVINGLIVING/DAY ST WHEREMIGHTY LEMON DR OUTM. CRENSHAW LP

1963FAITHLPLPSOLITUDECOUNTRYSPANISH

*NEW ORDER*REPLACEMENTSSIMPLE MINDSSUZANNE VEGAU2

ME2DIUMTHE BEARS?BEAT FARMERSDAVID BOWIECARLOS ALAMARDB'SDEPECHE MODEERASUREFIGURES/BEACHHOODOO GURUSJOHN HIATTICEHOUSEJULIAN COPEJESUWARY CHLEYJON

LPDARKLPLPLIESTRANGEVICTIM

LPPAGANLPCRAZY

APRIL

SPACELIME SPIDERSTHE LONG RYDERS INITZER EBB LPPAUL KELLY LPPAT METHENY LASTSCRUFFY THE CAT LPTHE SILENCERS LPSIOUXSIE SONGTHROWING MUSES SOAPTHAT PETROL EMO LPPETE WYLIE SINFUL

LIGHTSEE

10,000 MANIACS TALKLONELY/EYESORE LPNEW MODEL ARMY WHITEHWOOD BEYOND COLORBINKY PHILLIPS LPTHE CULT WILDICICLE WORKS JANETACKHEAD 12.TOM VERLAINE TOWN

NFYV JACKSONVILLEP.D. BRIAN TAYLORM.D. LEX STALEY/APDPH: 904-642-1055CON: FRED JACOBSMUSIC:TUE AFTCALLS:MON-THU 2- 4

HEAVY ADDSAEROSMITH DUDETHE CARS YOU

MEDIUM ADDSDAVID BOWIE NEVERMELVIN JAMES WHYPAUL KELLY DARLINGLIGHT ADDSPETE BARDENS DREAMSY&T TEMPTATION

POWER*DEF LEPPARDHOOTERSJ.C. MELLENCAMP*WHITESNAKEHEAVYBRYAN ADAMSJON BUTCHERCRUZADOSDEF LEPPARDDEF LEPPARD

/FABULOUS

TBIRDSGRATEFUL DEADGREAT WHITEJON ASTLEY?LOVERBOYRICHARD MARX/MOTLEY CRUEMR. MISTERTOM PETTY

ROGERWATERSU2JOE WALSHMEDIUMBEAT FARMERS?THE CULTFLEETWOOD MAC?GLEN BURTNICKSAMMY HAGARMASON RUFFNEROMAR/HOWLERSSTEPPENWOLF

?URGENTWARREN ZEVONUGHTDIOJOE ELYINSIDERSNEIL YOUNGTHE SILENCERSTWISTED SISTER

WOMENJOHNNY

HEREPAPER CD

VICTIMWISHBEDES

R!HYSTERIATEAR CDSPELLHELLROCK CDJANE CDNOTORIOUSSHOULD 0WILD 3

SOMETHINGMIXEDSUNSET (CD)STREETSCAR

DARKWILD (CDLITTLE CDFOLLOW CD

WORLD CDCD

CCDD

HOLD

CCDDDETOX

DREAMERLORD (CDGHOST (CDLONELYPAINTEDHOT

NOIR MANCHESTERP.D. JOHN ERDAHLM.D. KAREN A. SMALLPH: 603-625-6915

HEAVY ADDSAEROSMITHTHE CARSMEDIUM ADDSPAUL KELLYLIGHT ADDSSCOTT FOLSOM

YOUDUDE

DARLING

LISTEN

POWERLAARTBARBA ST

WHO CBAMBA

DHEPATTY SMYTH ISN'T CDHEAVY38 SPECIAL BACKDAVID BOWIE NEVER

(CD

BRYAN ADAMS VICTIMJON BUTCHER WISHES CDCRUZADOS BEDDEF LEPPARD WOMEN(EUROPE CARRIE (CD)IFLEETWOOD MAC LITTLEFLEETWOOD MAC MIDNIGHT (CDGRATEFUL CDGREAT WHITE ROCK fCDSAMMY HAGAR BOYS CDHOOTERS JOHNNY CDJ.C. MELLENCAMP PAPER CDJON ASTLEY JANE CDRICHARD MARX SHOULD CDNEIL YOUNG LONELYOUTFIELD SINCE CD)TOM PETTY MIXED CDU2 STREETS CD

MEDIUMBEAT FARMERS DARK CD)CROWDED HOUSE WORLD CDTHE CULT WILDDEF LEPPARD ANIMALDEF LEPPARD TEARDIO DREAMER (CD)FABULOUS TBIRDS SPELLINSIDERS GHOST

?LOVERBOY NOTORIOUSLIVING/DAY ST WHERE (CD)MR. MISTER SOMETHINGfNEWCITY ROCKERS REVROGER WATERS SUNSET (CD)THE SILENCERS PAINTEDSTARSHIP BABYLONSTEPPENWOLF HOLDTESLA ROCKTHE TRUTH UNTIL (CD)LIGHTCHARLIE DANIELS BOGGED (CD)LOST BOYS ST GOOD CDMARILLION INCOMMUN CDMELVIN JAMES WHYREPLACEMENTS ALEXTWISTED SISTER HOTJOE WALSH RADIOY&T

TEMPTATIONMI

YGLU JOHNSTOWNP.D. RICH ADAMSM.D. BRIAN WOLFEPH: 814-536-7825MUSIC:TUE MORCALLS:MON-TUE 10- 2

MEDIUM ADDSAEROSMITH DUDETHE CARS YOUCUTTING CREW LOVEFLEETWOOD MAC LITTLEHUEY LEWIS/NEWS DOIN

HEAVY38 SPECIAL BACKLA BARBA ST BRA 0))BRYAN ADAMS VICTIMJON BUTCHER WISHESCRUZADOS BED gli1DEF LEPPARD ANIMALDEF LEPPARD WOMENGRATEFUL DEAD HELL RIGRATEFUL DEAD TOUCH

?SAMMY HAGAR BOYSSAMMY HAGAR GIVE (CD)HEART WHOHOOTERS JOHNNYHOOTERS SATELLITE (CD)?INSIDERS GHOSTLOST BOYS ST GOOD (CD*LOVERBOY NOTORIOUS

?RICHARD MARX SHOULDTOM PETTY MIXED CDU2 STREETS CDJOE WALSH CAR C11

HERE CDMEDIUMBEAT FARMERS DARKDAVID BOWIE NEVERTHE BRANDOS GETTYSBURGTHE CALL WANNA CDCHARLIE DANIELS BOGGED CDCROWDED HOUSE WORLD CD!DIO DREAMER CD)

*EUROPE CARRIE CD)FABULOUS TBIRDS SPELLGLEN BURTNICK FOLLOWGREAT WHITE ROCK CD)*J.C. MELLENCAMP PAPER CD)LIVING/DAY ST WHEREMARILLION INCOMMUN CD)RICHARD MARX MEAN CD)MASON RUFFNER WORLDMELVIN JAMES WHYMR. MISTER SOMETHING (CD)OUTFIELD SINCEPAUL KELLY DARLING (CD)ROGER WATERS SUNSETTHE SILENCERS PAINTED (CD)PATTY SMYTH ISN'T (CD)STARSHIP OVERSTEPPENWOLF HOLD CD)SUZANNE VEGA LUKA CD)SUZANNE VEGA SOLITUDE CD)TWISTED SISTER HOT CD)U2 FOUND CD)WARREN ZEVON DETOX CD)LIGHTELTON JOHN CANDLE

VGTR MIAMIP.D. BILL WISEM.D. BEARMANPH: 305-759-4311CON: B -A -D -EMUSIC:TUE AFTCALLS:MON 10-12

HEAVY ADDS*AEROSMITH DUDETHE CARS YOUMEDIUM ADDSSAMMY HAGAR EAGLESMELVIN JAMES WHYWHITESNAKE IS

HEAVYCHARLIE DANIELS BOGGEDCRUZADOS BEDDEF LEPPARD WOMENEUROPE CARRIEGRATEFUL DEAD HELLSAMMY HAGAR GIVE

*J.C. MELLENCAMP PAPER*JON ASTLEY JANELOST BOYS ST GOODTOM PETTY MIXEDU2 STREETSWHITESNAKE HEREMEDIUMBRYAN ADAMSDEF LEPPARDDEF LEPPARD*DEF LEPPARDGRATEFUL DEADGRATEFUL DEADGREAT WHITESAMMY HAGARINSIDERSRICHARD MARXROGER WATERSJOE WALSH

VICTIMANIMALHYSTERIATEARPUSHTONSROCKBOYSGHOSTSHOULDSUNSETCAR

Radio Reports...Monday & Tuesday10am - 7pm EST

CHART KEY*= Top 5 Requestsr= Increased Rotation(CD) = CD Airplay

CDCDCDCDCDCD

CDCDCD

CD

CDCDCDCDCDCDCDCDCDCDCDCD

VGTU HAGERSTOWNP.D. DIRK DEVAULTPH: 301-791-3690MUSIC:MON AFTCALLS:MON-TUE 10- 7

MEDIUM ADDS

UIT'S ADDSIMMATERIAL DRIVING

HTDUMPTRUCK NOWHEREGEOFFREY DOWNES LP

OPAL LBONNIE HAYES SOMEP

THE PALADINS LPTOM WAITS HANG

HEAVY10,000 MANIACSANDY SUMMERSTHE BEARSDUANE EDDYECHO/BUNNYMENFIRE TOWNGRATEFUL DEADJOHN HIATT?HOOTERSHURRAHINCREDIBLE CAS.THE LONG RYDERSM. CRENSHAWPAUL KELLYREPLACEMENTSSCRUFFY THE CATTHE SILENCERSSIMPLE MINDSSUZANNE VEGAU2WARREN ZEVONMEDIUMBACK/BEACH STBEAT FARMERS

?THE BRANDOSTHE CUREGO-BETWEENSICICLE WORKS

(MIGHTY LEMON DRILIONS 6 GHOSTSLUCKY 7

?MOOD SIXNEIL YOUNG?NEW ORDERPAT METHENYPRIMITONSSTEVE GOODMANSHELLYAN ORPHANLITTLE STEVENTIREZ TIREZTRUE WESTLIGHTNEW MODEL ARMYBUCKWHEAT ZYDE.DB'SDWEEZIL ZAPPAJOE ELYFIGURES BEACHRUDE GIRLSJESSE C. YOUNGJESUS/MARY CHLAWNDALELIVING/DAY STPETER TOSHRADIO TOKYOBLUE RODEOROGER WATERS

AMSCRTHIRD WORLDTOM VERLAINEUB40WENDY 6 LISA

w5." L'ITT3FR1111s

PEACE

LPLPLPLPLPLPLPLPLPLPLPLPALEXLPLPLPLPLPLP

LPLPGETTYSBURGPTTYSBURGL

LPJANELP

LPMARY

LPLP

ASTHL

LPLPLPLPLP

LPLPLPLPLPLPLPAPRILLWHERELPLPLPLPLPLPTOWNLPLP

M.D. KIM ALEXANDERPH: 203-247-1060CON: B -A -D -ECALLS:MON-THU 11-03

HEAVY ADDSAEROSMITH DUDETHE CARS YOUSQUEEZE HOUR

ADDSLA SAMBA ST COMEGLEN BURTNICK FOLLOWHEART WAITTHE SILENCERS PAINTED

POWERDAVID BOWIE NEVER (CD)CROWDED HOUSE WORLDDEF LEPPARD WOMENEUROPE CARRIEHOOTERS JOHNNYJ.C. MELLENCAMP PAPER*JON ASTLEY JANE

LOVERBOYNOTORIOUS

EAVYTHE BEARS FEAR*CHARLIE DANIELS BOGGED SD,3ETHE CULT WILDDEF LEPPARD ANIMALFABULOUS TBIRDS SPELL

!GRATEFUL DEAD HELLGREAT WHITE ROCK

CDCD

LIVING/DAY ST WHERERICHARD MARX SHOULDMASON RUFFNER WORLD (CD)OMAR/HOWLERS MANTOM PETTY MIXEDREPLACEMENTS ALEXSUZANNE VEGA SOLITUDE CD

STREETS CD

CD

CDETOX (CD)

213;

JOE WALSHWARREN ZEVON

MEDIUMBACK/BEACH STTHE BRANDOS

*THE CALLDEF LEPPARDDIOGRATEFUL DEADINSIDERSMOTLEY CRUEMELVIN JAMESMR. MISTER?PETE BARDENSPAUL KELLYSLADESTEPPENWOLFTWISTED SISTERU22

UUGHT

BEAT FARMERSCRUZADOSFLEETWOOD MAC

PIPELINEGETTYSBURGWANNAEXCITABLEDREAMERWEST

CD

GHOST 1

WILD CDWHYSOMETHINGDREAMSDARLING (CD)LAHOLDHOTCOUNTRY 1E1TRIP CD

DARKBED (CD)MIDNIGHT

VWEB-FM PORTSMOUTHP.D. JEFF LEFTM.D. CHRIS GARRETTPH: 603-436-7300CON: JEFF POLLACKMUSIC:TUE AFTCALLS:MON-TUE 11- 6

HEAVY ADDSTHE CARS

MEDIUM ADDSAEROSMITHDAVID BOWIETHE CULTFABULOUS THIRDSINSIDERS

LIGHT ADDSECHO/BUNNYMENHEGE VHELIXMELVIN JAMESMR. MISTERTOM KIMMELTWISTED SISTERPETE WYLIE

HEAVY38 SPECIALBRYAN ADAMS

*JON BUTCHERCRUZADOS

*DEF LEPPARDFLEETWOOD MACGRATEFUL DEAD

*GRATEFUL DEAD*GREAT WHITESAMMY HAGAR

August 21 1987

YOU

DUDENEVERWILDSPELLGHOST

LIPSHOUSEWILDWHYSOMETHINGDANCEHOTSINFUL

BACKHEARTSWISHBEDESWOMENMIDNIGHTHELLTOUCHROCKBOYS

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (50)

THEHARD REPORT REPORTS

HEART WHuJON ASTLEY JANELOST BOYS ST GOOD*WHITESNAKE HEREMEDIUMLA BAMBA ST BAMBABEAT FARMERS DARKBRYAN ADAMS VICTIMTHE CALL WANNACHARLIE DANIELS BOGGEDCROWDED HOUSE WORLDROGER DALTREY FIREEUROPE CARRIEFABULOUS THIRDS STANDDEL FUEGOS NAMEGLEN BURTNICK FOLLOWHEGE V BURIALJ.C. MELLENCAMP PAPERLOVERBOY NOTORIOUSRICHARD MARX SHOULDOUTFIELD SINCETOM PETTY MIXEDROBERT CRAY WOMANREPLACEMENTS ALEXROGER WATERS SUNSETTHE SILENCERS PAINTEDPATTY SMYTH ISN'TSTARSHIP OVERU2 SPANISHU2 STREETSJOE WALSH CARWARREN ZEVON DETOXLIGHTDIO DREAMERJOE ELY LORDMARILLION INCOMMUNMASON RUFFNER WORLDNEWCITY ROCKERS REVPAUL KELLY DARLINGREFUGEE SURVIVAL

WIFS ANNAPOLISP.D. DAVID EINSTEINM.D. BOB SHOWACREPH: 301-263-1430

LIGHT ADDSDUKE/STRATOSPHR 1,18WHERE

ROYAL COURT.... CHANGEDSQUEEZE HOURSWIMMING/Q'S EPSWING/SISTER BREAKOUTTOM WAITS HANG

HEAVY10,000 MANIACSTHE CUREECHO/BUNNYMENGRATEFUL DEADJOHN HIATTPAT METHENYREPLACEMENTSTHE SILENCERSSIMPLE MINDS

SUZANVEGANEU2

XWARREN ZEVONMMNUMABCTHE BEARSBEAT FARMERSDAVID BOWIETHE BRANDOSTHE CALL

PEACE

NEWTOUCHTHANKLASNIGHTTCLUBPAINTEDMIRACLELUKAFOUNDJULYDETOX

WHENFEARDARKNEVERGETTYSBURGWANNA

ICURIOSITT/CAT MISFITDEPECHE MODE STRANGEDUANE EDDY LPFABULOUS THIRDS STANDFAITH NO MORE WEFIGURES BEACH STARSY. FRESH FELLOW LPFIRE TOWN . CARRYGO-BETWEENS LP

=MHOOTEAR LPRS

JOHNNY

'INSIDERS GHOSTICICLE WORKS JANEJ.C. MELLENCAMP PAPERJESSE C. YOUNG HIGHWAYJESUS/MARY CH APRILJON ASTLEY JANESTEVE JONES MERCYLOST BOYS ST GOODLIVING/DAY ST WHEREMIGHTY LEMON DR LP'LIME SPIDERS LPLOS LOBOS SHAKESM. CRENSHAW EASYMASON RUFFNER GYPSY

NEIL YOUNGOMAR/HOWLERSNEW ORDERPETER WOLFROGER WATERSSTAN CAMPBELLTIREZ TIREZtTOM VERLAINEKIHTDB'SDEAD MILKMENJOE ELYLUCKY 7PEE WEE HERMANPAUL KELLY

rig TNIRE10

LONELYHARDFAITHCOMERADIO

LYEARSPTOWN

LIELPLORDLPSURFINLP

M.D. GLENN STEWARTPH: 401-438-6110CON: JEFF POLLACKMUSIC:TUE AFTCALLS:THU-MON, 2

HEAVY ADDSAEROSMITH DUDETHE CARS YOUMEDIUM ADDSFABULOUS THIRDS SPELLHOOTERS SATELLITELIGHT ADDSTHE CULT WILDHELIX WILD

POWER/BRYAN ADAMS VICTIM

U2WHITESNAKE

STREETSHERE

FDilC

J.C. MELLENCAMP PAPER

HEAIL BAMBABARBA ST BAMBA

GRATEFUL DEAD HELL

DEF LEPPARDLITTLEWOMEN rE

FLEETWOOD MACl

CDCD

CROWDED HOUSE WORLDCRUZADOS BED

HOOTERS JOHNNYJON ASTLEY JANE CDLIVING/DAY ST WHEREtRICHARD MARX SHOULDTOM PETTY MIXEDPATTY SMYTH ISN'TMEDIUMDAVID BOWIE NEVERJON BUTCHER WISHESCHARLIE DANIELS BOGGEDDID DREAMER

SAMMY HAGARINSIDERS GHOST

BOYS 181CD

GREAT WHITE ROCK

LOVERBOY NOTORIOUSMOTLEY CRUE WILD CDMR. MISTER SOMETHING CDPAUL KELLY DARLING CDROGER WATERS SUNSET CDTHE SILENCERS PAINTED CDJOE WALSH CARLIGHTFASTER puss*CAT CHANGEMELVIN JAMES WHYREFUGEE SURVIVALREPLACEMENTS ALEX

(CD)

CDCD

03

Radio Reports...Monday & Tuesday10am - 7pm EST

WiMD HAMMONDP.D. S. CHAUVIN/OMM.D. PHIL COLWARTPH: 504-345-1070MUSIC:MON MORCALLS:MON-FRI 10- 2

HEAVY ADDSTHE CARS YOUFLEETWOOD MAC LITTLE

MEDIUM ADDSJON BUTCHER WISHESGLEN BURTNICK FOLLOWHEGE V HOUSEMELVIN JAMES WHYPAUL KELLY DARLINGSTEPPENWOLF HOLD

POWER38 SPECIAL

*LA BARBA ST BAMBAFLEETWOOD MAC MIDNIGHTGRATEFUL DEAD TOUCHSAMMY HAGAR GIVEHEART WHOHOOTERS JOHNNYHUEY LEWIS/NEWS DOIN*JON ASTLEY JANELOST BOYS ST GOODLIVING IN A BOX LIVINGOUTFIELD SINCE*WHITESNAKE HEREHEAVYABC WHENtDAVID BOWIE NEVERBRYAN ADAMS VICTIMCROWDED HOUSE WORLDCRUZADOS BED*EUROPE CARRIE*GREAT WHITE ROCKSAMMY HAGAR BOYSC.C. MELLENCAMP PAPERRICHARD MARX SHOULDTOM PETTY MIXEDPATTY SMYTH ISN'T/SUZANNE VEGA SOLITUDEU2 STREETSJOE WALSH CARWARREN ZEVON HYGIENE

MEDIUM10,000 MANIACS PEACEBEAT FARMERS DARKCUTTING CREW LOVETHE CURE WHYDASH RIPROCK OPERATIONFABULOUS THIRDS SPELLINSIDERS GHOSTLOST BOYS ST SHADOWSLOVERBOY NOTORIOUSLIVING/DAY ST WHEREMR. MISTER SOMETHINGM. TOMLINSON BELIEVETHE OTHER ONES HOLIDAYPETE HARDENS DREAMSTHE SILENCERS PAINTEDTOM KIMMEL FREEDOMPETE WYLIE SINFULWARREN ZEVON MONKEY

WITS ASBURY PARKP.D. RICH ROBINSONM.D. MIKE MARRONEPH: 201-493-2000MUSIC:TUE AFTCALLS:MON-TUE

HEAVY ADDSSQUEEZE HOURMEMUMADDSTHE SMITHSWARREN ZEVON TROUBLELIGHT ADDSABCDRAMARAMADUMPTRUCKJESUS/MARY CHMAX. AMERICAPAUL CARRACKTOM WAITSWILD FLOWERS

(CD)

(CD)

(CD)

(CD)

CD

(CD)

(CD)

CD)!)

(CD

(CD)

(CD)

(CD)

(CD)

(CD)

(CD)

GIRLFRIEND

DAYOUNOWHEREHAPPYMISSILESSHEDHANGWHERE

POWER'THE BRANDOS GETTYSBURG

I DBTHE

S LEAIE

CURE HEAVEN

ECHO/BUNNYMEN LIPS

/FIGURES/BEACHSTARS

FIRE TOWN FIRENEW ORDER FAITH'PAUL KELLY EXEREPLACEMENTS ALEXREPLACEMENTS SKYWAYHEAVYTHEISTEVECALLEARLE INSTEVE EARLE SATISFIEDPOE ELY FRENCH,FATAL FLOWERS WELL'GENE LOVES JEZ SUSPICIONGO-BETWEENS CUTLIME SPIDERS SPACEPET SHOP BOYS SINTHE SAINTS TEMPLETHE SILENCERS PAINTEDTHE SILENCERS REDSUZANNE VEGA EYETIREZ TIREZ WAKETHAT PETROL EMO SWAMPZODIAC MINDWARP PRIME

MEDIUMNEW MODEL ARMY WHITEANDY SUMMERS ALMOSTBEAT FARMERS DARKIBINKY PHILLIPS LPCRUZADOS LPFAITH NO MORE ANNIEHOODOO GURUS SCENEJOHN HIATT MEMPHISIT'S IMMATERIAL ROPEICICLE WORKS EVANGELINESTEVE JONES LPMOOD SIX I'NEIGHBORHOODS PUREPRIVATE DOMAIN ABSOLUTEPRIVATE SECTOR WISHRED HOUSE CHANCESRED HOUSE ISOLATIONSIOUXSIE SONGTOM VERLAINE CRYWIRE AMBITIOUSPETE WYLIE RULEX CYRANOWARREN ZEVON DETOXLIGHTNEW MODEL ARMY LPGLEN BURTNICK FOLLOWGLENRAH

MBURTNICK HEARDHURISS

ICICLE WORKS LPMIGHTY LEMON DR OUT'NEIL YOUNG EYESPETE HARDENS DREAMSUB40 CHERRYWILSONS CHILDPETE WYLIE SINFUL

WITC1 ORLANDOM.D. SLATSPH: 305-295-3990MUSIC:TUE AFTCALLS:MON-TUE 9- 2

HEAVY ADDSTHE CARS YOU

MEDIUM ADDSDAVID BOWIE NEVERMR. MISTER

HEAVYLA BAMBA ST BAMBA

*DANNY WILSON PRAYERFLEETWOOD MAC LITTLE

*GRATEFUL DEAD TOUCHHEART WHHOOTERS JOHNNYJ.C. MELLENCAMP PAPER*JON ASTLEY JANE'RICHARD MARX SHOULDOUTFIELD SINCESTARSHIP OVERU2 STREETS

SOMETHING

(CD)

CD

03

MEDIUMBRYAN ADAMS VICTIMGRATEFUL DEAD HELL (CD)GRATEFUL DEAD PUSH (CD)HOOTERS SATELLITEHUEY LEWIS/NEWS DOINTOM PETTY MIXEDTHE SILENCERS PAINTEDSUZANNE VEGA SOLITUDE

.U2 SPAU2

SPANISHNTRY (CD)

WBA-FM MADISONP.D. JACK MITCHELLPH: 608-274-5450CON: FRANK FELIXMUSIC:TUE AFTCALLS:MON 9-12

HEAVY ADDSTHE CARSMEDIUM ADDSAEROSMITH*DEF LEPPARDFLEETWOOD MACLOVERBOY

LIGHTADDSDAVID BOWIEFIRE TOWNGREAT WHITEINSIDERSRICHARD MARXMR. MISTER

HEAVY38 SPECIAL

*LA BAMBA STCROWDED HOUSEDANNY WILSONGRATEFUL DEADJ.C. MELLENCAMPRICHARD MARXTOM PETTYU2*WHITESNAKEMEDIUMFLEETWOOD MACSAMMY HAGARHEARTSTARSHIP

LIGHTCRUZADOS

*FLEETWOOD MACHOOTERS*LOST BOYS STTOM PETTY

YOU

DUDE (CD)ANIMALLITTLENOTORIOUS

{{CD

STREETS CD

NEVER (CD)RAINROCKGHOST (CD)SHOULDSOMETHING (CD)

BACKBARBASOMETHING s-51PRAYERTOUCHPAPER (CD)

MEMEAN

FilHEFOUND CD

RE

SEVENGIVEWHOOVER

BEDMIDNIGHTJOHNNYGOODMIXED

WMZ-FM KNOXVILLEP.D. JOHN 'LARSONM.D. MIKE CAPPSPH: 615-525-6000MUSIC:TUE MORCALLS:MON 2- 5

HEAVY ADDSAEROSMITHTHE CARSLEMUR ADDSBILLY IDOLLOST BOYS STLIVING/DAY STY&T

POWER*LA BAMBA ST BAMBAFLEETWOOD MAC LITTLE

*GRATEFUL DEAD TOUCHHANK WILLIAMS BOOGIE

OJOHNHEART WAITE TIMES*WHITESNAKE HEREHEAVY38 SPECIAL BACKBRYAN ADAMS VICTIMDEF LEPPARD ANIMALEUROPE CARRIEDAN FOGELBERG MATTERGREAT WHITE ROCK

*SAMMY HAGAR BOYSSAMMY HAGAR EAGLESJ.C. MELLENCAMP PAPERLOVERBOY NOTORIOUSRICHARD MARX SHOULDMR. MISTER SOMETHINGOUTFIELD HEARTSTARSHIP BABYLONMEDIUMBEAT FARMERSCROWDED HOUSECRUZADOSDEF LEPPARDDIOFIRE TOWNGLEN BURTNICKHOOTERSINSIDERSJON ASTLEYMOTLEY CRUEMELVIN JAMESTOM PETTY

(CD)

03(CD)

YOUDUDE

MONYSHADOWSWHERETEMPTATION

DARKWORLDBEDWOMEN

RDREAMERAINFOLLOWJOHNNY

JANEGHOST

WWHYILDMIXED

PAUL KELLY DARLINGROGER WATERS SUNSETTHE SILENCERS PAINTEDSUZANNESUZ VEGA SOLITUDE

THE TRUTH WEAPONSTWISTED SISTER HOT

WOO PHILADELPHIAP.D. DAVID DYEM.D. DAVID ANDERSONPH: 215-667-8100

03

(CD)

(CD)

(CD)

(CD)

HEAVY ADDSTHE CARS YOUGRATEFUL DEAD HELL

MEDIUM ADDSTHE CALL INECHO/BUNNYMEN LIPS CDFLEETWOOD MAC LITTLE CDMELVIN JAMES WHYSQUEEZE HOUR

POWERDAVID BOWIE NEVERJ.C. MELLENCAMP PAPERtJON ASTLEY JANEHEAVYBRYAN ADAMS VICTIMCROWDED HOUSE WORLD'FABULOUS THIRDS SPELLGRATEFUL DEAD STONES,INSIDERS GHOST'PETE HARDENS DREAMSTOM PETTY MIXEDPATTY SMYTH ISN'T (CD)U2 STREETSJOE WALSH CAR

MEDIUMBEAT FARMERS DARKJON BUTCHER WISHESROGER DALTREY FIRESTEVE EARLE SATISFIEDDAN FOGELBERG MATTERFIRE TOWN RAINHOOTERS SATELLITEMARILLION SUGARM. CRENSHAW MARY'PETER GABRIEL WALKROGER WATERS SUNSETTHE SILENCERS PAINTED

LIGHTLA BAMBA ST BAMBATHE BEARS FEAR (CD)BEV HILLS COP 2 SHAKEDAVID BOWIE TIMECROWDED HOUSE SOMETHING CDELTON JOHN LP CDFLEETWOOD MAC SEVEN CDGRATEFUL DEAD TOUCH CDHOOTERS JOHNNYRICHARD MARX MEANSUZANNE VEGA LUKASUZANNE VEGA SOLITUDEU2 FOUND (CD)

VOW SAVANNAHP.D. BILL WESTONM.D. VIRGIL THOMPSONPH: 912-897-1529CON: B -A -D -EMUSIC:TUE AFTCALLS:MON-TUE 02-04

HEAVY ADDS

FLEETWOODYOU

MAC LITTLEMEDIUM ADDSAEROSMITH DUDEJOHN HIATT FAITHMR. MISTER SOMETHINGWHITESNAKE ISLIGHT ADDSPAUL JANZ ELECTRICSTEPPENWOLF GIVE

POWERGRATEFUL DEADJ.C. MELLENCAMP

tU2JON ASTLEY

WHITESNAKEHEAVYDEF LEPPARDGREAT WHITEHOOTERSLOST BOYS STLOVERBOY

MEDIUMBEAT FARMERSBRYAN ADAMSCRUZADOSDEF LEPPARDDEF LEPPARDFABULOUS THIRDSGRATEFUL DEADGRATEFUL DEADSAMMY HAGARSAMMY HAGARINSIDERSLIVING/DAY STRICHARD MARXMELVIN JAMES'PETE HARDENSTOM PETTYROGER WATERSPATTY SMYTHJOE WALSHWARREN ZEVON

LIGHTTHE CULTDIODANNY WILSONSUZANNE VEGAURGENT

(CD)

CD

I((CD)i

TOUCH CDPAPER CD

STREETSCD

EHERE

WOMENROCKJOHNNYGOODNOTORIOUS

DARKVICTIMBEDANIMALHYSTERIASPELLHELLWEST

HOMEGHOSTWHERE

WSHHYOULDDREAMSMIXEDSUNSETISN'TCARDETOX

WILDDREAMERPRAYER

TAKESOLITUDE

WOT TOLEDOP.D. KEITH MASTERSM.D. JIM STEELPH: 419-248-3377CON: JON SINTON/B -A -D-E

MEDIUM ADDSAEROSMITHTHE CARS

UGHTADDSOMAR/HOWLERS

HEAVY38 SPECIAL BACK

}BRYAN ADAMS VICTIMIEUROPE CARRIEGRATEFUL DEAD. TOUCHSAMMY HAGAR GIVEHEART WHO

*J.C. MELLENCAMP PAPERSTARSHIP OVER

*WHITESNAKE HEREMEDIUMCRUZADOS BEDDEF LEPPARD ANIMALDEF LEPPARD TEAR

*DEF LEPPARD WOMEN'DANNY WILSON PRAYERFABULOUS THIRDS SPELLFLEETWOOD MAC LITTLEGRATEFUL DEAD HELL*GREAT WHITE ROCKSAMMY HAGAR HOMEHOOTERS JOHNNY'INSIDERS GHOSTJON ASTLEYLOVERBOYRICHARD MARXMR. MISTERTOM PETTYROGER WATERSPATTY SMYTHSUZANNE VEGAU2JOE WALSHLIGHTDIOPETE HARDENSTHE SILENCERS

WYY BALTIMOREP.D. TOM EVANSM.D. CHRIS EMRYPH: 301-889-0098CON: B -A -D -EMUSIC:TUE AFTCALLS:MON 1-03

DUDEYOU

DANCING

CD

CD

ISE1CD

CDCDCDCDCDCDCDCDCDCDCDCD

CDCD

CDCD

CDCD

(CD)

(CDCDCD

CDCDCD

CDCD

CD

NOTORIOUS(CD)

SHOULD (CD)SOMETHINGMIXED CD

ISNSUNS'T CET CD

SOLITUDE CDSTREETS CDCAR CD

DREAMER CDDREAMS CDPAINTED CD

HEAVYADDSCROWDED HOUSE SOMETHING (CD)

MEDIUM ADDSAEROSMITH DUDE (CD)THE CARS YOU

HEAVYGRATEFUL DEAD TOUCHHEART WHOJ.C. MELLENCAMP PAPERRICHARD MARX MEAN

OVERFINERSTREETSHERE

STARSHIPSTEVE WINWOODU2WHITESNAKEMEDIUMBEAT FARMERS DARKDEF LEPPARD ANIMALDEF LEPPARD EXCITABLEDEF LEPPARD GODSEUROPE IECARRGRATEFUL DEAD HELLGRATEFUL DEAD WESTGREAT WHITE ROCKSAMMY HAGAR BOYSSAMMY HAGAR HOMEHOOTERS JOHNNYJON ASTLEY JANELOVERBOY NOTORIOUSLIVING/DAY ST WHERERICHARD MARX SHOULDMR. MISTER SOMETHINGNEWCITY ROCKERS REV

*OUTFIELD SINCEPETE HARDENS DREAMSTOM PETTY MIXEDPAUL KELLY DARLINGTHE SILENCERS PAINTEDSTEPPENWOLF HOLDSUZANNE VEGA SOLITUDETHOMPSON TWINS GETU2U2 SPBULLET

H

CHART KEY* = Top 5 Requests

= Increased Rotation(CD) = CD Airplay

CDCD

CDCDCDCDCD

igN

03(CD)

igl

(CD)

(CD)

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (51)

TAIRD REPORTSCONTINUED

WZN BURLINGTONP.D. STEVE CORMIERPH: 802-877-6800MUSIC:TUE AFTCALLS:MON 11- 2

MEDIUM ADDSAEROSMITHLOVERBOYOUTFIELDROGER WATERS

POWER*GRATEFUL DEADHEARTHOOTERS

tMASON RUFFNERU2JOE WALSH

HEAVY

DUDENOTORIOUSHEARTSUNSET

HELLWHOJOHNNYWORLDSTREETSCAR

BACKLA BAMBA ST SAMBAIBEAT FARMERS DARKDAVID BOWIE NEVERBRYAN ADAMS VICTIMTHE CALL WANNA*CROWDED HOUSE WORLDCRUZADOS BEDFLEETWOOD MAC MIDNIGHTJ.C. MELLENCAMP PAPERJON ASTLEY JANETOM PETTY THINKtTHE SILENCERS PAINTEDSUZANNE VEGA SOLITUDEWARREN ZEVON BADMEDIUMJONTHE CARS

BUTCHER WISHES (CD)

STEVE EARLE SATISFIEDFABULOUS THIRDS SPELL

i CDCD

THE CURE HEAVEN CD

GLEN BURTNICK FOLLOW

LIVING/DAY STRICHARD MARXMELVIN JAMESOMAR/HOWLERSPAUL KELLYROBERT VAUGHNSTEPPENWOLF

MEW NASHVILLE

WHERESHOULDWHYMANDARLINGJUSTICEHOLD

P.D. JUDY Mcnu*tTM.D. DAVID HALLPH: 615-244-9533CON: LARRY BRUCEMUSIC:TUE AFTCALLS:THU 3- 5

HEAVY ADDSDISORDERLIES ST EDGEHUEY LEWIS/NEWS DOINMEDIUM ADDS*AEROSMITH DUDETHE CARS YOUSAMMY.HAGAR HOME

POWER38 SPECIAL BACKJON BUTCHER WISHESDEF LEPPARD WOMEN

*EUROPE CARRIEGRATEFUL DEAD TOUCHOUTFIELD SINCEtPATTY SMYTH ISN'TTOM KIMMEL FREEDOMJOHN WAITE TIMESWHITESNAKE HERE

HEAVYCHARLIE DANIELS BOGGEDCRUZADOS BEDDEF LEPPARD ANIMALDEF LEPPARD HYSTERIAGREAT WHITE ROCKHOOTERS JOHNNYJ.C. MELLENCAMP PAPERLOST BOYS ST GOOD

*LOVERBOY NOTORIOUSTOM PETTY MIXEDU2 TRIPMEDIUMAUTOGRAPH NEVERBRYAN ADAMS VICTIMTHE CULT WILD*DEF LEPPARD SUGARDIO DREAMERFABULOUS THIRDS SPELLDAN FOGELBERG MATTERGLEN BURTNICK FOLLOWRICHARD MARX SHOULDMELVIN JAMES WHYMR. MISTER SOMETHINGOMAR/HOWLERS MANPAUL KELLY DARLING

*ROYAL COUR'S.... CHANGEDTHE SILENCERS PAINTEDSTEPPENWOLF HOLDSUZANNE VEGA SOLITUDE

CARTAKE

DETOX

URGENTJOE WALSHWARREN ZEVONLIGHTBEAT FARMERSFIRE TOWNMARILLIONTNTROBERT VAUGHN

DARKRAININCOMMUNJUSTICESTAR

W(FM SYRACUSEP.D. BRIAN ILLESPH: 315-487-1500CON: JEFF POLLACKMUSIC:TUE AFTCALLS:THU-FRI 10-12

HEAVY ADDS

*THECARS

MENUMADS*AEROSMIDTHCUTTING CREWGREAT WHITEMELVIN JAMESJOE WALSH

YOUSTREETS

DUDELOVEROCKWHYCAR

HEAVYLA BAMBA ST BAMBACRUZADOS BEDDEF LEPPARD WOMENGRATEFUL DEAD HELL

JOHNNYJ.C. MELLENCAMP PAPERJON ASTLEY JANESTARSHIP OVERJOHN WAITE TIMESMEDIUMBEAT FARMERSDAVID BOWIETHE BRANDOS*BRYAN ADAMS*DEF LEPPARDFLEETWOOD MACGLEN BURTNICKGRATEFUL DEADGRATEFUL DEADSAMMY HAGARJOHN HIATTINSIDERSLOVERBOYLIVING/DAY STMARILLIONRICHARD MARXMR. MISTEROUTFIELDTOM PETTYPAUL KELLYTHE SILENCERSPATTY SMYTHWARREN ZEVON

iSgi

CD

CD

CDCDCDCDCDCDCDCDCDCDCDCDCDCDCD

(CD(CD

CD

CD

iSg)

CDCDCDCD

CD

(CD)

(CD

(CD(CD

(CD)

(CD)

(CD)

(CD

(CD

(CD)

(CD)

(CD)

(CD)

03

(CD)

(CD)

CD

(CD)

CDCDCD

DARKNEVER (CD)GETTYSBURGVICTIM (CD)ANIMALLITTLEFOLLOW

HOMESTONES

THINGPICD

PUSH

GHOSTNOTORIOUSWHEREINCOMMUN (CD)SHOULDSOMETHINGSINCEMIXED (CD)DARLINGPAINTEDISN'T (CD)DETOX

Radio Reports...Monday & Tuesday10am - 7pm EST

W(GR W.PALM BEACHP.D. TOM STEVENSM.D. MIKE RYANPH: 305-832-0019.MUSIC:TUE AFTCALLS:TUE-THU 2- 5

HEAVY ADDSTHE YOUCUTTINGS CREW LOVE

MEDIUM ADDSWHITESNAKE ISLIGHT ADDSco*ck ROBIN JUSTCRUZADOS BEDHEART GIRLSUZANNE VEGA SOLITUDEWHITESNAKE HERE

POWERtHUEY LEWIS/NEWS DOINJ.C.*JON ASTLEYMELLENCAMP JANEPAPER

tRICHARD MARX SHOULDHEAVYGRATEFUL DEAD PUSHGRATEFUL DEAD TOUCHGRATEFUL DEAD WEST

CCO

HOOTERS JOHNNY*INSIDERS GHOSTMEDIUM38 SPECIAL BACKDAVID BOWIE NEVERBRYAN ADAMS VICTIMtJON BUTCHER WISHESCROWDED HOUSE WORLDDANNY WILSON PRAYER 03LIVING/DAY ST WHEREtMELVIN JAMES WHYMR. MISTER SOMETHING (CD)OUTFIELD SINCETOM PETTY MIXEDTHE SILENCERS PAINTEDLIGHTLA BAMBA ST SAMBATHE BRANDOS GETTYSBURGGLEN BURTNICK FOLLOWPETE HARDENS DREAMSROBERT VAUGHN JUSTICE

NKLC CHARLESTONP.D. BRIAN KRYSZ/OMM.D. DUANE DOHERTYPH: 304-722-3300CON: B -A -D -E

MEDIUM ADDSAEROSMITHTHE CARSMR. MISTERROGER WATERS,STARSHIP

LIGHTADDSLOST BOYS STY&TPAUL KELLY

HEAVYLA SAMBA STDEF LEPPARDECHO/BUNNYMENEUROPESAMMY HAGARHOOTERSJ.C. MELLENCAMPMOTLEY CRUEWHITESNAKEMEDIUMACE FREHLEYtBEAT FARMERSBRYAN ADAMSCUTTING CREWTHE CUREDEF LEPPARDDEF LEPPARDDIODANNY WILSONFLEETWOOD MACGREAT WHITEHEARTHEARTHEARTHOOTERSLOST BOYS STLOVERBOYLIVING/DAY STRICHARD MARXMELVIN JAMESPETE HARDENSPOISONSTARSHIPSTEPPENWOLFSUZANNE VEGATWISTED SISTERtWHITE LIONLIGHTTHE BEARSBRIAN MCDONALDDAVID BOWIEDAVID BOWIETHE BRANDOSBRUCE co*ckBURNSTEVE EARLEFARRENHEITFASTER puss*CATFIRE TOWNJOHN HIATTTHE SILENCERSSUZANNE VEGATESLATNTTONIO KURGENTULTRAVIOLET

W(LS-FM ATLANTA

YOUDUDE

SOMETHINGSUNSETBABYLONSTREETS

SHADOWSDARLINGTEMPTATION

BAMBAANIMALNEWCARRIEGIVEJOHNNYPAPERWILDHERE

(CD)

CDCD

(CD)

ROCKDARKVI TIM (CD)LOVEHEAVENHYSTERIALOVEDREAMERPRAYER CDLITTLE CDROCK CD

WITHSATELLITE (CD)GOODNOTORIOUS

WHYSHOULDDREAMSACTIONOVERHOLDLUKA (CD)HOTWAIT

FEARLIFEBANGNEVERGETTYSBURGWAITING

LSAOSTTISFIEDCHANGERAINTHANKPAINTEDSOLITUDEROCK

TAKE

STARSEX

HOME

P.D. BILL PUGHM.D. BETH KEPPLEPH: 404-325-0960CON: B -A -D -EMUSIC:MON AFTCALLS:FRI-MON 9-12

HEAVY ADDSAEROSMITH DUDETHE CARS YOU

MEDIUM ADDSBILLY IDOL MONYDEF LEPPARD HYSTERIASTARSHIP BABYLONWHITESNAKE IS

LIGHT ADDSSTEPPENWOLF HOLDY&T TEMPTATION

HEAVYCUTTING CREW LOVE

*DEF LEPPARD WOMENEUROPECARRIEGRATEFUL DEAD TOUCH

*GREAT WHITE ROCK 03J.C. MELLENCAMP PAPER

*JON ASTLEY JANEtIAVERBOY NOTORIOUSROGER WATERS SUNSET (CD)

*U2*WHITESNAKEMEDIUM

HEREBULLET

THE BEARS FEARBRYAN ADAMS VICTIM

THECHARCULILTE D ANIELS BOGGEDIGG (CD)

DEF LEPPARD EXCITABLEDEF LEPPARD ROCKETDIO DREDISORDERLIES ST EDGEAMERFABULOUS THIRDS SPELLGRATEFUL DEAD HELL CDGRATEFUL DEAD WESTSAMMY HAGAR HOME CD)HOOTERSINSIDERS

JOHNNYGHOST

RICHARD MARX SHOULD gililMR. MISTER SOMETHINGOMAR/HOWLERS MAN (CD)PAUL KELLY DARLINGTHE SILENCERS PAINTED (CD)SUZANNE VEGA sorl-Trinr

U2WARREN ZEVON

LIGHTGLEN BURTNICKJOHN HIATTMELVIN JAMES

STREETSDETOX

FOLLOW

WHYTHING

VKLT KALKASKAP.D. DAVE FORTNEYPH: 616-947-0003CON: B -A -D -EMUSIC:TUE MORCALLS:MON-TUE 10- 2

HEAVY ADDSAEROSMITH DUDETHE CARS YOU

HEAVY*DEF LEPPARD WOMENFLEETWOOD MAC MIDNIGHTGRATEFUL DEAD TOUCHGREAT WHITESAMMY HAGAR nggg*HOOTERS JOHNNYJ.C. MELLENCAMP PAPER (CD)*JON ASTLEY JANELOST BOYS ST GOODOUTFIELD SINCEU2*WHITESNAKE HERRE

Stee*tsMEDIUMLA BAMBA ST BAMBABEAT FARMERS DARKDAVID BOWIE NEVER

iSglCUTTING CREW LOVECHARLIE DANIELS BOGGEDCROWDED HOUSE WORLD (CD)THE CULT WILD (CD)THE CURE HEAVENROGER DALTREY FIREDEF LEPPARD ANIMALDEF LEPPARD EXCITABLEDEF LEPPARD HYSTERIADIO DREFABULOUS THIRDS SPELLERGLEN BURTNICK FOLLOWGRATEFUL DEAD HELLGRATEFUL DEAD WESTSAMMY HAGAR BOYSINSIDERS GHOSTLOVERBOY NOTORIOUSLIVING/DAY ST WHERERICHARD MARX SHOULDMASON RUFFNER WORLDMELVIN JAMES WHYMR. MISTER SOMETHINGOMAR/HOWLERS MAN*PETE HARDENS DREAMSTOM PETTY MIXEDPAUL KELLY DARLINGROGER WATERS SUNSETTHE SILENCERS PAINTEDPATTY SMYTH ISN'TSUZANNE VEGA SOLITUDETESLA ROCK

WOO LEXINGTONP.D. PETER DELLOROM.D. STACY YELTONPH: 606-254-9316MUSIC:TUE MORCALLS:THU-FRI 02-50

LIGHT ADDSAEROSMITHTHE CARSHEGE VMR. MISTER

HEAVYtBRYAN ADAMS VICTIMHEART' WHOHOOTERS JOHNNY

1

J.C. MELLENCAMP PAPERJON ASTLEY JANEU2WHITESNAKE HERE

MEDIUM38 SPECIAL BACKLA SAMBA ST BAMBAtTHE BEARS FEARDAVID BOWIE NEVERJON BUTCHER WISHESTHE CALL WANNACHARLIE DANIELS BOGGEDCRUZADOS BEDGRATEFUL DEAD TOUCH*GREAT WHITE ROCKSAMMY HAGAR BOYSINSIDERS GHOSTLOST BOYS ST GOODtPETE HARDENS DREAMSTOM PETTY MIXEDPAUL KELLY DARLINGJOE WALSH CARJOE WALSH FUNLIGHTBEAT FARMERS DARKDEF LEPPARD WOMENFABULOUS THIRDS SPELL*GRATEFUL DEAD HELLSAMMY HAGAR HOMERICHARD MARX SHOULDTHE SILENCERS PAINTED

W(QZ SAGINAWP.D. PAUL CHRISTYM.D. CHRISTY ADAMSPH: 517-695-5115MUSIC:TUE MORCALLS:FRI-MON 10- 2

MEDIUM ADDSBRYAN ADAMSTHE CARSROGER DALTREYSAMMY HAGARSAMMY HAGARLOVERBOYOUTFIELDSTARSHIPJOE WALSHLIGHT ADDSDEF LEPPARD ANIMALDEF LEPPARD HYSTERIAWHITESNAKE HEREWHITESNAKE ISWHITESNAKE STILL

HEAVY*LA SAMBA ST BAMBA*GRATEFUL DEAD TOUCH*HEART WHO+LOST BOYS ST GOODMEDIUMCRUZADOS BEDFLEETWOOD MAC MIDNIGHT*GREAT WHITE ROCKHOOTERS JOHNNYJ.C. MELLENCAMP PAPERRICHARD MARX SHOULDROGER WATERS SUNSETU2 STREETSJOHN WAITE TIMESLIGHTDEF LEPPARD WOMENDIO DREAMER

YOUHOME

FIREEAGLESGIVENOTORIOUSHEART

BABYLON

MKWO COLUMBIAP.D. GARY L. ROBBINSM.D. ART BOERKEPH: 803-771-4850MUSIC:MON AFTCALLS:MON-TUE 2- 4

LIGHT ADDSCRUZADOSDEF LEPPARDHEGE VMELVIN JAMESMR. MISTERTOM KIMMELWARREN ZEVON

YOUDUDE

HOUSESOMETHING (CD)

(C33

(CD)

iCCE1

FD1

(CD)

(CD)

(CD)

(CD)

(CD)

iSE33

03

SE))3

fE

SB3

(CIS)

fCD

SMALLHYSTERIA

WHYHOUSESOMETHINGDANCEMONKEY

HEAVY38 SPECIALLA BAMBA STCHARLIE DANIELSCRUZADOSDEF LEPPARDGRATEFUL DEADGRATEFUL DEADGREAT WHITEHEARTHOOTERSJ.C. MELLENCAMPJON ASTLEYLOST BOYS STOUTFIELDTOM PETTYWHITESNAKEWARREN ZEVON

MEDIUMBEAT FARMERSBRYAN ADAMSJON BUTCHERTHE CALLCROWDED HOUSETHE CULTDIOFABULOUS THIRDSFABULOUS THIRDSFLEETWOOD MACGLEN BURTNICKSAMMY HAGARSAMMY HAGARHUEY LEWIS/NEWSRICHARD MARXMASON RUFFNERPAUL KELLYREPLACEMENTSROGER WATERSTHE SILENCERSPATTY SMYTHSTEPPENWOLFSUZANNE VEGATOM KIMMELTHE TRUTHTWISTED SISTERU2JOHN WAITEJOE WALSHLIGHTDAVID BOWIETHE CULTDEF LEPPARDEUROPEFLEETWOOD MACGRATEFUL DEADGUNS N. ROSESSAMMY HAGARHEARTHEGE VJOHN HIATTHOOTERSICICLE WORKSLIVING/DAY ST

BACKSAMBABOGGEDBEDWOMENHELLTOUCH

WHOROCK

JOHNNYPAPERJANEGOODSINCEMIXEDHEREDETOX

DARKVICTIMWISHESWANNAWORLDWILDDREAMERSPELLSTANDMIDNIGHTFOLLOWBOYSGIVEDOINSHOULDWORLDDARLINGALEXSUNSETPAINTEDISN'THOLDSOLITUDEFREEDOMUNTILHOTSTREETSTIMESCAR

NEVERPEACEANIMALCARRIELITTLEWESTWELCOME

BADHOME

BURIALTHINGSATELLITEJANEWHERE

MKXL-FM,CONQQR9NHP.D. RhNEt. BLAKEPH: 603-225-5521MUSIC:TUE AFTCALLS:TUE-FRI 2- 5

MEDIUM ADDSFLEETWOOD MAC MIDNIGHTLIGHT ADDSBUCKWHEAT ZYDE. LPTHE CARS

DANCEHEROESMELVIN JAMES WHYNEW ORDER FAITHTOM VERLAINE ONEPETE WYLIE SINFUL

HEAVYLA SAMBA ST LPTHE BEARS FEARBEAT FARMERS DARK/THE CALL WANNATHE CURE BEAUTIFULECHO/BUNNYMEN NEWGRATEFUL DEAD TOUCHJOHN HIATT THANKHOOTERS JOHNNYJON ASTLEY JANERICHARD MARX MEANOMAR/HOWLERS' HARDSTARSHIP OVERU2 LPU2 SPANISHtJOHN WAITE TIMESWHITESNAKE HEREMEDIUMBACK/BEACH ST PIPELINEDAVID BOWIE NEVER

tTHE BRANDOS GETTYSBURGCROWDED HOUSE WORLDDANNY WILSON PRAYERFABULOUS THIRDS STANDFLEETWOOD MAC LPGRATEFUL DEAD BLACKGRATEFUL DEAD WESTHEART WHOLIVING IN A BOX LIVINGLIVING/DAY ST WHEREMARILLION LPRICHARD MARX SHOULDNEIL YOUNG LONGPETE HARDENS DREAMSPSEUDO ECHO FUNKYROBERT CRAY WOMANREPLACEMENTS NIGHTCLUBROBERT VAUGHN JUSTICESCRUFFY THE CAT LPTHE SILENCERS LPTHE SILENCERS PAINTEDSTEPPENWOLF HOLDSUZANNE VEGA LUKASUZANNE VEGA SOLITUDET'PAU HEARTURGENT INCHLIGHTANIMAL LIB.co*ck ROBINDUANE EDDYEUROPEGLEN BURTNICK

LPJUSTROCKESTRACARRIEFOLLOWSATELLITE

INSIDERS GHOSTICICLE WORKS JANEJ.C. MELLENCAMP PAPERLOST BOYS ST SHADOWSMASON RUFFNER WORLDMR. MISTER SOMETHINGNEIGHBORHOODS PUREOUTFIELD SINCEPAUL KELLY DARLING

V -FM RAND RAPIDS. . UAW, LANGE

M.D. ARTS HAMPERSPH: 616-456-5461CON: B -A -D -E

MEDIUM ADDSAEROSMITH DUDETHE YOUMELVINCARS JAMES WHY

HEAVY38 SPECIAL BACKLA SAMBA ST BAMBADEF LEPPARDDEF LEPPARD GODSDEF LEPPARD

ANIMAL

HYSTERIADEF LEPPARD WOMENFABULOUS THIRDS STANDFLEETWOOD MAC MIDNIGHTGRATEFUL DEAD HELLGRATEFUL DEAD TOUCHGRATEFUL DEAD WEST*SAMMY HAGAR BOYSSAMMY HAGARHEARTHEARTHOOTERSHOOTERSJON ASTLEYLOST BOYS ST*MARILLIONPATTY SMYTHSTARSHIPU2U2U2WHITESNAKEMEDIUMDAVID BOWIE

HOMEGIRLWHOJOHNNYSATELLITEJANEGOODINCOMMUN CDISN'T CDOVER CDBULLET CDSPANISHSTREETS (CD)HERE (CD)

NEVER (PP)

(CD)

CDCDCDCDCDCDCDCDCD

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (52)

THEHARD REPORT REPORTS

CONTINUEDBRYAN ADAMS VICTIMco*ck ROBIN JUSTCROWDED HOUSE WORLDCRUZADOS BEDTHE CURE HEAVEN

IC) DREAMERSTEVE EARLE SATISFIEDEUROPE CARRIEFABULOUS TBIRDS SPELLTHE FIXX SCAREDGLEN BURTNICK FOLLOWINSIDERS GHOST

*J.C. MELLENCAMP PAPERLOVERBOY NOTORIOUSLIVING/DAY ST WHEREMARILLION TIMERICHARD MARX

*PETE BARDENSPETE HARDENSTOM PETTYPAUL JANZPAUL KELLYPAT METHENYROGER WATERSTHE SILENCERS

DREAMSSEASCAPEMIXEDONEDARLINGLASTSUNSETPAINTEDBABYLON

STEPPENWOLF HOLDSUZANNE VEGA EYETANGERINE DREAM CENTURYTOM KIMMEL DANCETWISTED SISTER LOVEJOE WALSH CAR

NLIR-FM LONG ISLANDP.D. DENIS MC NAMARAM.D. LARRY DUCK DUNNPH: 516-485-9200MUSIC:TUE AFTCALLS:MON-WED 1- 5

MEDIUM ADDSBILLY IDOL MONYIT'S IMMATERIAL DRIVING

LIGHT ADDSLIVING/DAY ST WHERE

POWERAHALA BAMBA ST

(THE CARSCOLOURFIELDTHE CURE

*THE CURETHE CURECURIOSITY/CATDEPECHE MODEDANNY WILSON

*ECHO/BUNNYMENECHO/BUNNYMEN,FAT BOYS?GENE LOVES JEZHURRAHORDER

PETORDER

PET SHOP BOYSPAUL KELLY

*REPLACEMENTSSIMPLE MINDSSUZANNE VEGAWARREN ZEVON

HEAVYABCDAVID BOWIEICICLE WORKSTHE SILENCERSTONIO KU2UB40

MEDIUM

(Cu)

18CD)

1E1CD

(CD)

CDCDCDCDCDCDCDCDCD

CDCDCD

(CD)

LIVINGBYOUSHEBEAUTIFULHEAVENPERFECTMISFITSTRANGEPRAYERLIPSNEWWIPEOUTSUSPICIONIFFAITHSINDARLINGALEXLEYEMONKEY

WHENNEVERJANE

PAINTEDSPANISHLP

AMAZULU MONTEGOANDY SUMMERS LOVEHWOOD BEYOND LPBELOUIS SOME LETTHRASHING DOVES JESUSFAITH NO MORE WETHE FIXX LPY. FRESH FELLOW LPJESUS/MARY CH APRILJON ASTLEY JANEALISON MOYET WEAKPSEUDO ECHO LISTENINGPSY FURS SHOCKT'PAU HEARTX LYYELLO YEAHZETTE FREAK

LIGHTDINGO BOINGO WESUZANNE VEGA LUKATHAT PETROL EMO BIGPETE WYLIE SINFUL

VLLZ DETROITP.D. DOUG PODELLM.D. JIM PEMBERTONPH: 313-855-5100CON: JEFF POLLACKMUSIC:TUE AFTCALLS:MON-FRI 9- 5

HEAVY ADDSDEF LEPPARD

MEDIUM ADDSAEROSMITHTHE BRANDOSTHE CARSTHE CULTTHE CUREERIC CLAPTONFLEETWOOD MACHELIX

i2THEAVYBRYAN ADAMSBRYAN ADAMSDEF LEPPARDGRATEFUL DEAD(SAMMY HAGARSAMMY HAGARHEARTJ.C. MELLENCAMPRICHARD MARXTOM PETTYJOHN WAITEWHITESNAKEWHITESNAKEMEDIUM38 SPECIALDAVID BOWIECHARLIE DANIELSROGER DALTREYFABULOUS THIRDSGLEN BURTNICKGRATEFUL DEADGREAT WHITEJOHN HIATTINSIDERSLOST BOYS STLOVERBOYLIVING/DAY STMOTLEY CRUEGARY MOOREMR. MISTEROUTFIELDPAUL KELLYROGER WATERSTHE SILENCERSSTARSHIPSTEPPENWOLFTOM KIMMELTNTTWISTED SISTER HOTU2JOE WALSH

ANIMAL

DUDEGETTYSBURG (CD)YOUWILDHEAVENHOLDTANGOWILDPROMISES (CD)TEMPTATION

HEARTSVICTIMWOMEN

BOYSTOUCH

EAGLESWHOPAPERSHOULDMIXED

HERETIMES

IS

CDCDCDCD

'CDCDCDCDCDCD

NEVER CDBOGGEDFIRESPELL (CD)FOLLOWWESTROCK(CD;THINGGHOSTGDNOTORIOUS (CD)WHEREWILDILDSTHING iCDCDSOMETHING

CD

HEARTDARLINGSUNSET

1 CD)PAINTED CDBABYLON CDHOLDDANCESTAR Iggi

STREETS (CD)GUM (CD)

Radio Reports...Monday & Tuesday10am - 7pm EST

W.NZ LANSINGP.D. RICK VAN GILPH: 517-669-8361CON: B -A -D -EMUSIC:MON AFTCALLS:MON-FRI 02-05

HEAVY ADDSAEROSMITHTHE CARSMEDIUM ADDSSTARSHIPWHITESNAKEWARREN ZEVON

YOUDUDE

ISBABYLONDETOX

(CD)

03HEAVY(DEF LEPPARD ANIMALGRATEFUL DEAD TOUCH

[ gglJ.C. MELLENCAMP PAPERILOVERBOY NOTORIOUSWHITESNAKE HERE (CD)MEDIUMLA BAMBA ST SAMBATHE BEARS FEARBEAT FARMERS DARKDAVID BOWIE NEVER (CD)BRYAN ADAMS VICTIM CDCUTTING CREW LOVE CDTHE CULT WILD CDTHE CURE HEAVEN CDDEF LEPPARD EXCITABLEDEF LEPPARD HYSTERIADEF LEPPARD LOVEDEF LEPPARD ROCKETDEF LEPPARD WOMENDIO DREAMER CDEUROPE CARRIE CDFABULOUS TBIRDS SPELL CDFIRE TOWN RAINGRATEFUL DEAD HELLGRATEFUL DEAD WEST

CD

*GREAT WHITE ROCKSAMMY HAGAR HOME CD

INSIDERS',JON ASTLEYLIVING/DAY STRICHARD MARXMELVIN JAMESMR. MISTEROMAR/HOWLERSPETE HARDENSTOM PETTYPAUL KELLYPAT METHENYROGER WATERSTHE SILENCERSPATTY SMYTHSTEPPENWOLFSUZANNE VEGAJOE WALSH

GHOST(CD)JANE

WHERE

WHYSHOULDSOMETHINGMAN CDDREAMS CDMIXE CDDARLING CDLAST CDSUNSET CD

ISN'TPAINTED CD33

HOLD CDSOLITUDE CDCAR CD

NLUP CHICAGOP.D. GREG SOLKM.D. DAVE BENSONPH: 312-440-5270

POWER ADDSTHE YOUCARS

HEAVYADDS

MEDIUM ADDSCOMELA SAMBA ST

AEROSMITH DUDE

POWERco*ck ROBIN JUST(CROWDED HOUSE WORLDCRUZADOS BED (CD)INSIDERS GHOSTJ.C. MELLENCAMP PAPER

WHITESNAKEJANEJON ASTLEY

HEAVY

LA SAMBA STBACKSAMBA

38 SPECIAL

GRATEFUL DEAD TOUCH (CD)HOOTERS JOHNNYRICHARD MARX SHOULD

MEDIUMDANNY WILSON PRAYERFABULOUS TBIRDS STANDFLEETWOODFLEETWOOD MAC LITTLEFLEETWOOD MAC MIDNIGHT

[

EVERYSICD

MAC

GRATEFUL DEAD HELLMELVIN JAMES WHYTHE MONKEES HEARTPAUL KELLY DARLINGSUZANNE VEGA SOLITUDEU2 SPANISHU2 STREETS (CD)U2 TREEJOE WALSH CARLIGHTSTEVE EARLE SATISFIEDOUTFIELD SINCEROGER WATERS RADIOSTAN CAMPBELL YEARS

MVO COLUMBUSM.D. WENDY STEELEPH: 614-224-1271CON: JON SINTON/B-A-D-EMUSIC:TUE AFTCALLS:WED-FRI 10- 2

MEDIUM ADDSAEROSMITHDAVID BOWIETHE CARS

DUDENEVERYOU

HEAVY38 SPECIAL BACK

?BRYAN ADAMS VICTIM (CD)DEF LEPPARD ANIMALDANNY WILSON PRAYERGRATEFUL DEAD TOUCHSAMMY HAGAR GIVEHEART WHO(J.C. MELLENCAMP PAPERSTARSHIP OVER

1U2 STREETSCD

WHITESNAKE HEREMEDIUMTHE BEARS FEARTHE BRANDOS GETTYSBURGCHARLIE DANIELS BOGGEDCRUZADOS BEDDEF LEPPARD HYSTERIADEF LEPPARD WOMENDIO DREFABULOUS TBIRDS SPELLERFLEETWOOD MAC LITTLEGRATEFUL DEAD HELLGREAT WHITE ROCKSAMMY HAGAR HOME (CD)HOOTERS JOHNNYJON ASTLEY JANELOST BOYS ST GOOD (CD)LOVERBOY NOTORIOUSLIVING/DAY ST WHERERICHARD MARX SHOULDMASON RUFFNER WORLD [gglMR. MISTER' SOMETHINGPETE HARDENS DREAMSTOM PETTY MIXEDPAUL KELLY DARLING (CD)ROGER WATERS SUNSETPATTY SMYTH ISN'TSUZANNE VEGA SOLITUDE

NUR MILWAUKEEP.D. BRUCE MCGREGORM.D. KELLY WALLACEPH: 414-453-4130CON: B -A -D -EMUSIC:TUE MORCALLS:MON-FRI 9- 5

HEAVY ADDSAEROSMITHTHE CARSLOVERBOY

MEDIUM ADDSDAVID BOWIETHE CUREDEF LEPPARD

DUDEYOUNOTORIOUS

NEVERHEAVENEXCITABLE

HOOTERS SATELLITEMELVIN JAMES WHYSTARSHIP BABYLONWHITESNAKE IS

HEAVY38 SPECIAL BACK*CRUZADOS BED(DEF LEPPARD ANIMALDEF LEPPARD WOMENGRATEFUL DEAD TOUCH (CD)HEART WHOHOOTERS JOHNNY*J.C. MELLENCAMP PAPERYJON ASTLEY JANE*WHITESNAKE HEREMEDIUMTHE BEARS FEARBEAT FARMERS DARKCONCRETE BLONDE DANCEBRYAN ADAMS VICTIMJON BUTCHER WISHESTHE CALL WANNA (CD)CROWDED HOUSE WORLDTHE CULT LOVETHE DAMNED ALONEDEEP PURPLE CALLDEF LEPPARD HYSTERIAFABULOUS TBIRDS SPELLFLEETWOOD MAC MIDNIGHTFIRE TOWN RAINGLEN BURTNICK FOLLOWGRATEFUL DEAD HELLGRATEFUL DEAD WEST 03GENESIS DEEP*GREAT WHITE ROCKSAMMY HAGAR HOMEINSIDERS GHOSTSTEVE JONES MERCYLIVING/DAY ST WHEREMARILLION INCOMMUNRICHARD MARX SHOULD (CD)MASON RUFFNER WORLDNEIL YOUNG LONELYOMAR/HOWLERS MANPETE HARDENS DREAMSTOM PETTY MIXED (CD)TOM PETTY THINKPAUL KELLY DARLINGREPLACEMENTS ALEX (CD)RICK MEDLOCKE SATURDAYROGER WATERS SUNSETTHE SILENCERS PAINTEDSTEPPENWOLF HOLDSUZANNE VEGA SOLITUDE (CD)THE TRUTH UNTILU2 RED (CD)U2 STREETSJOE WALSH CARX JULYWARREN ZEVON DETOXWARREN ZEVON HYGIENELIGHTLA BAMBA ST BAMBATHE CURE WHY (CD)DEF LEPPARD GODSDIO DREAFARRENHEIT LOSTMER

NMAD MADISONP.D. BILL ROBBINSM.D. PAUL MARSZALEKPH: 608-249-9277CON: TOM TEUBER

POWER ADDSFLEETWOOD MACHOOTERS

ME2

DIUM ADDSco*ck ROBINLIGHT ADDSDB'SJOE ELYFABULOUS TBIRDS

POWER?CROWDED HOUSECRUZADOSFIRE TOWNGRATEFUL DEAD*HOOTERSJ.C. MELLENCAMRTOM PETTYSUZANNE VEGAWARREN ZEVON

HEAVYJON BUTCHER(THE CARSINSIDERS

/JESSE C. YOUNGPETE BARDENSPAT METHENYJOE WALSH

MEDIUMTHE BEARSBEAT FARMERS(DAVID BOWIETHE CURELYLE LOVETTOMAR/HOWLERS*REPLACEMENTSROGER WATERS

1THE SILENCERSSTEPPENWOLFIGHTTHE CULTECHO/BUNNYMEN*GREAT WHITELOST BOYS STPAUL KELLYROBERT VAUGHN

LITTLEKARLASTREETS

JUST

WORKINGLUCKYSPELL

WORLDBERAINHELLJOHNNYPAPERMIXEDSOLITUDEDETOX

WISHESYOUGHOSTHIGHWAYDREAMSLASTTIME

TRUSTDARKNEVERHEAVENWHYDANCINGALEXGOINGPAINTEDHOLD

(CD)

(CD)

D[ CCDD

C

(CD)

(CD)

CD

CD))CD

igE

(CD)

WILDNEWROCK (CD)GOODDARLINGJUSTICE

NIMDK PETERBOROUGHP.D. MIKE THOMASPH: 603-924-7165MUSIC:TUE MORCALLS:TUE 12- 5

HEAVY ADDSTHE CARS

MEDIUM ADDSDB'SD. MASONGRATEFUL DEADTOM VERLAINELIGHT ADDSDUMPTRUCKTHROWING MUSESTOM WAITSWENDY & LISA

YOU

LPLP

LSTONESP

NOWHERELPIMP G

POWERDAVID BOWIE NEVERHEAVY10,000 MANIACS LPNEW MODEL ARMY WHITEANDY SUMMERS LOVELA BAMBA ST LPBACK/BEACH ST ABSOLUTEBACK/BEACH ST SIGNTHE CALL WANNACRUZADOS LP(CURIOSITY/CAT MISFITECHO/BUNNYMEN LPTHE FIXX SCAREDGLEN BURTNICK FOLLOWHOOTERS LPJ.C. MELLENCAMP PAPERMIGHTY LEMON DR LPLIME SPIDERS LPMOOD SIXNEW ORDER FAITHPAUL KELLY LPROBERT VAUGHN JUSTICETHE SILENCERS LPSIMPLE MINDS ALIVESIMPLE MINDS FORGETSTAN CAMPBELL MISUNDERSTEPPENWOLF HOLDSWING/SISTER BREAKOUTTHE TRUTH UNTIL

LPMEDIUMABC WHENBEAT FARMERS

LP

BINKY PHILLIPS LPBUCKWHEAT ZYDE. LPtDAVE PERKINS YOUDUANE EDDY ROCKESTRADUANE EDDY SPIESJOHN FARNHAM PRESSUREFIGURES/BEACH LP

GO-BETWEENSLUCKY 7RICHARD MARX,ALISON MOYET?NEIGHBORHOODSPETE HARDENSTHE SAINTSLITTLE STEVEN

(TIREZ TIREZUB40URBAN BLIGHTLIGHTTHE BRANDOSJOE ELYHEGE VLIONS & GHOSTSPETE WYLIE

CUT

SHOULDWRONG

DREAMSHOWLPLP

LP

GETTYSBURGLORDHOUSEMARYSINFUL

$111FAIWAY-M-RnifL1/70-M.D. JIM SPECTORPH: 609-641-1400MUSIC:MON MORCALLS:TUE 11- 3

HEAVY ADDS

FABULOUS THIRDS SPELLFLEETWOOD MAC LITTLEMEDIUM ADDSAEROSMITHLIGHT ADDSOMAR/HOWLERSREPLACEMENTSTOM KIMMELPETE WYLIE

POWERBRYAN ADAMSCRUZADOS

*GRATEFUL DEAD}GRATEFUL DEADGRATEFUL DEADHOOTERS

*J.C. MELLENCAMPTOM PETTY,ROGER WATERStU2JOEHEAVY WALSH

LA SAMBA STDAVID BOWIEJON BUTCHER*DEF LEPPARDTHE FIXX*SAMMY HAGARHOOTERS(INSIDERS,JON ASTLEYILOVERBOYLIVING/DAY STRICHARD MARXSTARSHIPSTEPPENWOLF*WHITESNAKEMEDIUMBEAT FARMERSROGER DALTREYDIOEUROPEGLEN BURTNICKGREAT WHITE(OUTFIELDPAUL KELLYROBERT VAUGHNTHE SILENCERSSUZANNE VEGAURGENTWARREN ZEVONLIGHTTHE BRANDOSTHE CULTMELVIN JAMESMR. MISTERPETE HARDENSGREGG ROLIESKAGARACK

DUDE

MANALEXDANCESINFUL

VICTIMBEDHELLPUSHWESTJOHNNYPAPERMIXEDSUNSETSTREETSCAR

SAMBANEVERWISHESWOMENSCARED

SSATELLITE

JANEGHOST

NOTORIOUSWHERESHOULDBABYLONHOLDHERE

0)

((CD)

(9CDCD

(CD)

CD)CD)

03(CD)

(CD)

(CD)

FIREDARK

DREAMERCARRIE (CD)FOLLOWROCK (CD)HEARTDARLINGJUSTICEPAINTEDSOLITUDE

DETOX l(DETOX CD

GETTYSBURGWILD (CD)WHYSOMETHINGDREAMSHANDSALONE

VMMR PHILADELPHIAP.D. TED UTZ/OMM.D. ERIN RILEYPH: 215-561-0933CON: B-A-D-E/HARRIS COM/POLLACK

HEAVY ADDSTHE CARSMEDIUM! ADDSAEROSMITHLIGHT ADDSDEAD MILKMENOMAR/HOWLERS

POWERLA SAMBA ST BAMBAtDAVID BOWIE NEVERFLEETWOOD MAC SEVENGRATEFUL DEAD TOUCHHOOTERS JOHNNYJ.C. MELLENCAMP PAPERRICHARD MARX MEANROGER WATERS RADIO*WHITESNAKE HEREHEAVY*GRATEFUL DEADGRATEFUL DEADGRATEFUL DEADHOOTERS*HOOTERSROGER WATERSU2U2MMNUMBRYAN ADAMS

*DEF LEPPARD*DEF LEPPARDGLEN BURTNICKHEARTINSIDERSJON ASTLEYLOVERBOYMASON RUFFNERPETE HARDENSREPLACEMENTSJOE WALSHWARREN ZEVONLIGHTTHE CA ICHARLIELL DANIELS BOGGEDECHO/BUNNYMEN BEDMELVIN JAMES WHYTHE SILENCERS PAINTED

YOU

DUDE

BIGMAN

HELLPUSHSTONESENGINESATELLITESUNSETCOUNTRYSPANISH

VICTIMANIMALWOMENFOLLOWWHO

JANEGHOST

NOTORIOUSWORLDDREAMS

CARALEX

TROUBLE

VMRY ST.LOUISP.D. TED HABECKM.D. KIM POOLPH: 618-397-2002

HEAVY ADDSAEROSMITHTHE CARSHOOTERSMEDIUM ADDSTHE BEARSHEART

HEAVYBEAT FARMERS DARKCHARLIE DANIELS BOGGED

*CRUZADOS BED (CD)FABULOUS THIRDS SPELL

GRATEFUL DEAD TOUCHGRATEFUL DEAD WEST

IEEICD

GRATEFUL DEAD HELLGRATEFUL DEAD PUSH

*GREAT WHITE ROCKSAMMY HAGAR BACKSAMMY HAGAR BOYSSAMMY HAGAR HOME*HOOTERS JOHNNY:INSIDERS GHOSTJ.C. MELLENCAMP PAPER(LIVING/DAY ST WHERE

ROGER WATERS RADIOROGER WATERS SUNSET RU2 STREETS CD

I1ROGER WATERS POWERS

JOE WALSH CARMEDIUMBACK/BEACH ST CATCHTHE BRANDOS GETTYSBURGROGER DALTREY FIREFLEETWOOD MAC EVERY (CD)

(CD)

(CD)

DUDEYOUSATELLITE

HONEYGIRL

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (53)

THE REPORTSCONTINUED

FLEETWOOD MACGLEN BURTNICKJON ASTLEYLOST BOYS STRICHARD MARXMELVIN JAMESNEIL YOUNGPETE HARDENSPAUL KELLYPAT METHENYGREGG ROLIEROBERT VAUGHNTHE SILENCERSSUZANNE VEGAPETE WYLIEYWARREN ZEVON

LITTLEFOLLOWJANEGOOD (CD)SHOULDWHYLONELYDREAMSDARLINGLAST (CD)HANDSJUSTICEPAINTEDSOLITUDE (CD)SINFULTEMPTATIONDETOX (CD)

MKS MONTPELIER. VTP.D. STEVE ZINDM.D. JODY PETERSEN.PH: 802-223-2396MUSIC:TUE AFT

HEAVY ADDSTHE CARSDB'SDB'SHOOTERS

MEDIUM ADDSBACK/BEACH STCUTTING CREWD.L. JONESPETE HARDENSSWING/SISTERWENDY & LISA

HEAVY,LA BAMBA ST LPtBEV HILLS COP 2 LPFABULOUS TBIRDS LPFLEETWOOD MAC LPGRATEFUL DEAD TOUCHJOHN HIATT LP?LYLE LOVETT LPMASON RUFFNER BABYTOM PETTY LP}PRIVATE PARTS LPtU2 LPJOE WALSH LPWARREN ZEVON LP

DIUM

YOUCHANGELIEJOHNNY

ABSOLUTELOVELPDREAMSBREAKOUTLP

(CD)

CD)CDCD

(CD)

(CD)

10,000 MANIACS PEACE (CD)/BEAT FARMERS LPTHE BRANDOS GETTYSBURGBUCKWHEAT ZYDE. LPco*ck ROBIN JUSTCRUZADOS LPSTEVE EARLE LP (CD)ELEANOR LPtBONNIE HAYES SOMEHUGH MASEKELA LPtICICLE WORKS LPJ.C. MELLENCAMP PAPER (CD)JESSE C. YOUNG LPtLOST BOYS ST LPLUCKY 7 LPtM. CRENSHAW EASY (CD)ALISON MOYET LPM. TOMLINSON LPPAUL KELLY LPPAT METHENY LAST

ISTAN CAMPBELL LPSUZANNE VEGA SOLITUDE (CD)URBAN BLIGHT LPLIGHTOMAR/HOWLERS LPROCK AND HYDE LP

ITRINSCRVUFFY

O LPTHE CAT LP

VIEW -FM NEW YORKP.D. MARK CHERNOFFPH: 212-286-1027CON: JEFF POLLACKMUSIC:TUE AFTCALLS:MON-FRI 9- 2

HEAVY ADDS*AEROSMITH DUDE*THE CARS YOUMEDIUM ADDSFLEETWOOD MAC LITTLESAMMY HAGAR HOMEWHITESNAKE IS

HEAVY .

LA BAMBA ST SAMBADAVID BOWIE NEVERCROWDED HOUSE WORLDROGER DALTREY FIREDEF LEPPARD WOMEN

tDANNY WILSON PRAYERFLEETWOOD MAC MIDNIGHTGRATEFUL DEAD HELLGRATEFUL DEAD PUSHGRATEFUL DEAD TOUCHGRATEFUL DEAD

WWESHOTHHOOTERS JOHNNYJ.C. MELLENCAMP PAPERLOST BOYS ST GOOD/LIVING/DAY ST WHEREROGER WATERS SUNSETU2 COUNTRYU2 STREETSWHITESNAKE HEREMEDIUMLA BAMBA ST COMEBACK/BEACH ST CATCH

*THE BRANDOS GETTYSBURG CD)BRYAN ADAMS VICTIM (CD)co*ck ROBIN JUSTCRUZADOS BEDTHE CULT WILD 01DEF LEPPARD ANIMALDIO DREAMERFABULOUS THIRDS SPELL*GLEN BURTNICK FOLLOWGREAT WHITE ROCK (CD)HOOTERS KARLAHOOTERS SATELLITEINSIDERS GHOSTJON ASTLEY JANE (CD)LOVERBOY NOTORIOUSMARILLION SUGARRICHARD MARX SHOULDMASON RUFFNER WORLD 01MELVIN JAMES WHYMR. MISTER SOMETHINGOMAR/HOWLERS MANTOM PETTY MIXEDPAUL KELLY DARLINGROBERT CRAY WOMANREPLACEMENTS ALEXROBERT VAUGHN JUSTICEPATTY SMYTH ISN'TU2

JOE WALSH CARWARREN ZEVON DETOX

01

V1NGZ ELMIRAP.D. TOM HEIGHTM.D. CHARLIE FOSTERPH: 607-535-2779MUSIC:MON AFTCALLS:MON-FRI 10- 2

HEAVY ADDSHUEY LEWIS/NEWSLIGHT ADDSROGER DALTREYFABULOUS THIRDSGLEN BURTNICKINSIDERSLOST BOYS STPETE BARDENSTOM KIMMEL

DOIN

FIRESPELLFOLLOWGHOSTSHADOWSDREAMSDANCE

HEAVY38 SPECIAL BACKLA BAMBA ST SAMBABEV HILLS COP 2 SHAKEBRYAN ADAMS HEARTSCUTTING CREW LOVECROWDED HOUSE WORLD

CDCD

,CDCDCD

CDCDCDCD

(CD)

CDCDCDCD

(CD)

(CD)

(CD)

(CD)

(CD)

EUROPE CARRIEFABULOUS THIRDS STANDGRATEFUL DEAD HELLGRATEFUL DEAD TOUCH

SAMMY HAGARROCKI

GREAT WHITE

HEART WHO (CD)HOOTERS JOHNNYLOST BOYS ST GOOD

OUTFIELD SINCE(CDRICHARD MARX MEAN

STARSHIP OVERSUZANNE VEGA LUKASTEVE WINWOOD BACKU2 FOUND

STREETSTIMES

(CD)

DARBAMKBA

VICTIMYOUBEDTOUCHROCKJOHNNY

JANEPAPERWAYSHOULDMIXEDUNTILSTREETSHERE (CD)

NEVERWISHESINWOMENDREAMER

THIRDS SPELLDEAD HELLDEAD PUSHDEAD STONESDEAD WEST

GHOSTNOTORIOUSWHEREWILDSOMETHINGLONELYDARLINGPAINTEDTREE (CD)CARDETOX

STEPPENWOLFSUZANNE VEGATESLATOM KIMMELU2JOE WALSHJOE WALSHWHITE LIONY&

LIGHTSACK/BEACH ST PIPELINEDAVID BOWIE NEVERJON BUTCHER WISHESCROWDED HOUSE WORLDOEF LEPPARD HYSTERIA310 DREAMERFASTER puss*CAT CHANGEFIRE TOWN CARRYGLEN BURTNICK FOLLOWGUNS N' ROSES WELCOMEHOOTERS JOHNNYRICHARD MARX SHOULDOMAR/HOWLERS MANPETE BARDENS DREAMSROYAL COURT.... CHANGED

JOHN WAITEMEDIUMBEAT FARMERS DARKDAVID BOWIE NEVERBRYAN ADAMS VICTIMJON BUTCHER WISHESTHE CA YOUCHARLIERS DANIELS BOGGEDCRUZADOS BEDDEF LEPPARD WOMENDANNY WILSON PRAYERJ.C. MELLENCAMP PAPERJON ASTLEY JANELOVERBOY NOTORIOUSLIVING/DAY ST WHERERICHARD MARX SHOULDMOTLEY CRUE WILDMR. MISTER SOMETHINGPAUL JANZ SENDPAUL KELLY DARLINGREO SPEEDWAGON DREAMSTHE SILENCERS PAINTEDPATTY SMYTH NEVERSUZANNE VEGA SOLITUDEJOE WALSH CARLIGHTTHE BEARSTHE BRANDOSDIOJOE ELYFLEETWOOD MACFROZEN GHOSTFIRE TOWNHEROESTHE MONKEESREFUGEEREPLACEMENTSROBERT VAUGHNSTEPPENWOLFURGENT

MR -M gQIIFIQLKP.u. RON REKGER

FEARGETTYSBURGDREAMERLORDLITTLE

RAINPROMISESDRIFTAWAYHEART

ALEXSURVIVALJUSTICEHOLDTAKE

M.D. D HILLARY/APDPH: 804-623-9667

MEDIUM ADDSAEROSMITH DUDE

HEAVYLA SAMBA STBEAT FARMERSBRYAN ADAMSTHE CARSCRUZADOS*GRATEFUL DEAD',GREAT WHITEHOOTERSJ.C. MELLENCAMPJON ASTLEYLITTLE AMERICARICHARD MARXTOM PETTY

!THETRUTH

WHITESNAKEMEDIUMDAVID BOWIEJON BUTCHERTHE CALLDEF LEPPARDDIOFABULOUSGRATEFULGRATEFULGRATEFULGRATEFULINSIDERSLOVERBOYLIVING/DAY STMOTLEY CRUEMR. MISTERNEIL YOUNGPAUL KELLYTHE SILENCERSU2JOE WALSHWARREN ZEVON

UGHTTHE CULT WILDFASTER puss*CAT CHANGEGUNS N' ROSES WELCOMESAMMY HAGAR BOYSMASON RUFFNER WORLDROGER WATERS SUNSET

VWPO CANTONF.D. ERIC ST. JOHNM.D. BRANDON SCOTTPH: 216 -343 -9696MUSIC:TUE AFTCALLS:TUE 12- 5

HEAVY ADDSTHE CARSMEDIUM ADDSCUTTING CREWMR. MISTERTNT

YOU

SOMMETHING iCDSTAR CD

HEAVY38 SPECIAL BACKLA SAMBA ST BAMBABEAT FARMERS DARK (CD)THE CALL WANNACHARLIE DANIELS BOGGED (CD)DEF LEPPARD WOMENEUROPE CARRIEGRATEFUL DEAD TOUCHGREAT WHITE ROCK*MOTLEY CRUE ALL*NEWCITY ROCKERS REVURGENT TAKE

*WHITESNAKE HERE(CD)

Y&T TEMPTATIONMEDIUMCRUZADOS BED*DEF LEPPARD ANIMALFABULOUS THIRDS SPELLSAMMY HAGAR BOYSHUEY LEWIS/NEWS DOIN

J.C. MELLENCAMP PAPERINSIDERS GHOST

(((CD)

CDCDKEEL WAITING

LOVERBOY NOTORIOUSMASON RUFFNER WORLD (CD)MOTLEY CRUE WILDPRETTY MAIDS FUTURE

SURVIVALHOLD (CD)SOLITUDEROCKFIVEBULLETCARFUNWAITCONTAGIOUS

(CD)

(CD)

(CD)

CD

NONE -FM AKRONP.D. WARD HOLMESM.D. MIKE MICHELLIPH: 216-535-7831CON: AL SNEED

HEAVY ADDSTHE CARS

MEDIUM ADDSAEROSMITHBRIAN MCDONALD

JOHN HIATTMELVIN JAMES

YOU

DUDELIFEBELIEVETHINGWHY

HEAVY38 SPECIAL BACK

*LA BAMBA ST BAMBAEUROPE CARRIEtFLEETWOOD MAC LITTLE*GRATEFUL DEAD TOUCH (CD)*HEART WHOHUEY LEWIS/NEWS DOIN*J.C. MELLENCAMP PAPERRICHARD MARX MEANOUTFIELD . SINCEWHITESNAKE HERE

MEDIUMBEAT FARMERS DARKDAVID BOWIE NEVERBRYAN ADAMS VICTIMJON BUTCHER WISHESCRUZADOS BEDDEF LEPPARD WOMENFABULOUS TBIRDS SPELLGRATEFUL D

*GREAT WHITEEAD ROCKSAMMY HAGAR BOYSHOOTERS JOHNNYINSIDERS GHOSTJON ASTLEY JANELOVERBOY NOTORIOUSLIVING/DAY ST WHERERICHARD MARX SHOULD

tOMAR/HOWLERS MANPETE BARDENS DREAMSTOM PETTY MIXEDPAUL KELLY DARLINGROGER WATERS SUNSETTHE SILENCERS PAINTEDSTEPPENWOLF HOLDSUZANNE VEGA SOLITUDE (CD)TOM KIMMEL DANCE

URGENT S TTARKEEETS

JOE WALSH CARLIGHTTHE CURE HEAVENGLEN BURTNICK FOLLOW

VOOJ FT MYERSP.D. PAT DEISCHM.D. STEVE AVERYPH: 813-275-9665CON: JEFF POLLACKMUSIC:TUE AFTCALLS:FRI-MON 1- 3NO REPORT

HEAVY38 SPECIAL BACKLA SAMBA ST SAMBAFLEETWOOD MAC MIDNIGHTJ.C. MELLENCAMP PAPERSTARSHIP OVER

MEDIUM

CRUZADOSDEF LEPPARD ANIMAL

BED piCD

DAVID BOWIE NEVERTHE CALL WANNA

DEF LEPPARD WOMEN

GREAT WHITE ROCK(CD)GRATEFUL DEAD HELL

HOOTERS JOHNNYLOVERBOY NOTORIOUSMARILLION INCOMMUN (CD)RICHARD MARX SHOULDMR. MISTER SOMETHING

U2 STREETS 01PATTY SMYTH ISNTLIGHTBEAT FARMERS DARKBRYAN ADAMS VICTIM (CD)DAMIOMY

HAGAR BDROYSEAMER

TOM PETTYMIXEDPAUL KELLY DARLING CD

SINSIDERS GHOST

ROGER WATERS SUNSETTHE SILENCERS PAINTEDSTEPPENWOLF HOLD (CD)URGENT TAKE

(CD)

(CD)

YOUR UTICAP.D. PETER HIRSCHM.D. TOM STARRPH: 315-797-0803MUSIC:TUE AFTCALLS:MON-TUE 2- 5

HEAVY ADDSTHE CARS YOU

MEDIUM ADDSFLEETWOOD MAC LITTLESTEPPENWOLF LIFE

LIGHT ADDSTHE BRANDOS NOTHINGCUTTING CREW LOVEco*ck ROBIN JUSTWHITESNAKE IS

POWERtGRATEFUL DEAD HELLJ.C.EAVY MELLENCAMP PAPER 01

H_LA BAMBA ST SAMBA/CROWDED HOUSE WORLDCRUZADOS BED 01DEF LEPPARD WOMEN*HOOTERS JOHNNYtHOOTERS KARLAINSIDERS GHOSTJON ASTLEY JANE (CD)TOM PETTY MIXEDPAUL KELLY DARLING (CD)ROGER WATERS SUNSET

!JOE WALSH ARS CPANISHWHITESNAKE HERE igEi

MEDIUMTHE BEARS FEARDAVID BOWIE NEVER (CD)BRYAN ADAMS VICTIMJON BUTCHER WISHESDEF LEPPARD ANIMALDIO DRFABULOUS TBIRDS SOFA

ROCKBOYS 01HOMENOTORIOUSWHERESUGAR (CD)

WHYSHOULD

SOMETHINGJUSTICEPAINTEDSOLITUDE (CD)

(CD)

CD

SAMMY HAGARtSAMMY HAGARLOVERBOYtLIVING/DAY STMARILLIONRICHARD MARXMELVIN JAMESMR. MISTERROBERT VAUGHNTHE SILENCERSSUZANNE VEGALIGHTBEAT FARMERS DARKFABULOUS TBIRDS SPELLFROZEN GHOST PROMISESGRATEFUL DEAD PUSH

HOOTERS GRAVEYARDSSGRATEFUL DEAD WEST i1

LOST BOYS ST SHADOWSMOTLEY CRUE WILDNEIL YOUNG LONELY (CD)WARREN ZEVON DETOX

(CD)

(CD)

CHART KEY= Top 5 Requests= Increased Rotation

(CD) = CD Airplay

VOXY OXFORDP.D. JOHN JESSERPH: 513-523-4114MUSIC:TUE AFTCALLS:MON-FRI 10- 4

MEDIUM ADDSTHE BRANDOSBELOUIS SOME

LIGHT ADDSMILLER DRAFTDUKE/STRATOSPHRDUMPTRUCKHEGE VMOJO NIXONTOM WAITSWENDY & LISA

HEAVYABCLA SAMBA STBEAT FARMERSDAVID BOWIETHE CALLCRUZADOSTHE CUREECHQ/BUNNYMENJOHN HIATTICICLE WORKSM. CRENSHAWALISON MOYETPAUL KELLYREPLACEMENTSREPLACEMENTSROYAL C. MOBTHE SILENCERSLITTLE STEVENX

GETTYSBURG (CD)LP

LPLPNOWHEREHOUSEELVISHNGWATERFALL

WHEN

DARBAMBA

KLPLPLPLPLPLPLPEASYISLPEPLPLPLPLPLP

WARREN ZEVON LPMEDIUM10,000 MANIACS LP

tNEW MODEL ARMY LPBACK BEACH ST LPBUCKWHEAT ZYDE. LPBRUCE co*ckBURN LP'S LP

DEAD MILKMEN LPDAVE PERKINS YOUSTEVE EARLE LPJOE ELY LPFIRE TOWN LPGRATEFUL DEAD LPGO-BETWEENS LPHOOTERS LPIMMACULATE FOOL LPJESSE C. YOUNG LPJON ASTLEY LPMIGHTY LEMON DR LPNEIGHBORHOODS LPPRIVATE DOMAIN LPSCRUFFY THE CAT LPTOM VERLAINE TOWNWILD FLOWERS LP

LIGHTBINKY PHILLIPS LPBRIAN BRAIN LPco*ck ROBIN JUSTCURIOSITY/CAT LPDUANE EDDY LPELEANOR LPVARIATIONS II LPFACTORY COMPIL. LPFIGURES BEACH LPY. FRESH FELLOW LPGENE LOVES JEZ SUSPICIONHURRAH LPJESUS/MARY CH APRILLOST BOYS ST GOODLIVING/DAY ST WHERELIME SPIDERS LPLUCKY 7 LP

rTILTVATTIVEM.D. PAM BROOKSPH: 914-471-1500CON: HARRIS COMMUNICATIONSMUSIC:MON MORCALLS:MON-WED 3- 4

POWER ADDSTHE CARS

HEAVY ADDSCUTTING CREWHOOTERS

MEDIUM ADDSAEROSMITHEDDIE MONEY

LIGHT ADDSBILLY IDOL

POWER*LA SAMBA ST BAMBA

*GRATEFUL DEAD TOUCH 2',31

*FLEETWOOD MAC SEVEN

HEART WHOHOOTERS JOHNNYJ.C. MELLENCAMP PAPER (CD)RICHARD MARX MEANSUZANNE VEGA LUKA (CD)U2 STREETS (CD)

HEAVYDAVID BOWIE NEVERCHARLIE DANIELS BOGGEDCROWDED HOUSE WORLD

FLEETWOOD MAC LITTLE CDCRUZADOS BED

tGRATEFUL DEAD PUSH CDHUEY LEWIS NEWS DOINRICHARD MARX SHOULDTOM PETTY MIXEDSTARSHIP OVER (CD)SUZANNE VEGA SOLITUDE?U2 COUNTRY (CD)WHITESNAKE HERE

MEDIUM '

BRYAN ADAMS VICTIM (CD)*DEF LEPPARD WOMENGLEN BURTNICK FOLLOWGRATEFUL DEAD HELL (CD)GRATEFUL DEAD WESTHOOTERS SATELLITEINSIDERS GHOSTJON ASTLEY JANELIVING/DAY ST WHEREMARILLION SUGARMR. MISTER SOMETHINGROGER WATERS SUNSETU2 BULLETU2 SPANISHLIGHTACE FREHLEY ROCKGREAT WHITE ROCKBONNIE HAYES SOMEGARY MOORE FRIDAYTWISTED SISTER HOT

August 21, 1987

(CD)

YPLR NEW HAVEN

YOU

LOVEON

SHOULDDUDE

MONY

P.D. JOHN GRIFFINM.D. CHRISTINAPH: 203-287-9070MUSIC:TUE AFTCALLS:MON-FRI 2 -

HEAVY ADDSAEROSMITHLA SAMBA STTHE CARS*DEF LEPPARDU2MEDIUM ADDSGLEN BURTNICKNEIL YOUNG

POWERDAVID BOWIECRUZADOS1DEF LEPPARDEUROPEFLEETWOOD MAC*GRATEFUL DEAD

5

DUDECOMEYOUANIMALSTREETS

FOLLOWLONELY

NEVER CDBED CDWOMEN CDCARRIE CDLI CDHELL CDJOHNNY

J.C. MELLENCAMP PAPER CDJON ASTLEY JANE CD*WHITESNAKE HEREHEAVYTHE BEARS FEAR CDBRYAN ADAMS VICTIM CDTHE CALL IN CDFABULOUS TBIRDS SPELLGREAT WHITE ROCK (CD)INSIDERS GHOSTLOVERBOY NOTORIOUSLIVING/DAY ST WHERE (CD)RICHARD MARX SHOULD (CD)

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (54)

THEHARD REPORT REPORTS

CONTINUEDMASON*MOTLEY

RUFFNCRUEWER WORLD

MELVIN JAMES WHYMR. MISTER SOMETHINGREPLACEMENTS ALEXROGER WATERS SUNSET

MEDIUMBEAT FARMERS DARKCUTTING CREW LOVEco*ck ROBIN JUSTFIRE TOWN RAINTOM PETTY MIXEDPAUL KELLY DARLINGTHE SILENCERS PAINTEDSTEPPENWOLF HOLDSUZANNE VEGA SOLITUDEJOE WALSH CARWARREN ZEVON BOOM

VQBK-FM ALBANYP.D. BOB WELCHPH: 518-462-5555MUSIC:TUE AFTCALLS:MON-TUE 10-12

CDCDCDCD

CD

CDCD

CDCDCDCDCDCDCDCD

HEAVY ADDS

MEINUM ADDTHE CARS

SYOU

AEROSMITH DUDE CD)FABULOUS TBIRDS SPELLMR. MISTER SOMETHING CDPAUL KELLY DARLING CD

HEAVYtBACKIBEACH ST PIPELINECRUZADOS BED CD1GRATEFUL DEAD HELL CDHEART WHO CDHOOTERS JOHNNYJ.C. MELLENCAMP PAPERTOM PETTY

STREETS CDU2 STREETS iCDMEDIUMDAVID BOWIE NEVER CDBRYAN ADAMS VICTIM CDJON BUTCHER WISHES CDFLEETWOOD MAC LITTLE CDGRATEFUL DEAD PUSH CDGRATEFUL DEAD STONES CDGRATEFUL DEAD WEST CDMARILLION SUGAR CDRICHARD MARX SHOULD CDNEIL YOUNG LONELY CDNEIL YOUNG PRISONERS 'CDROGER WATERS SUNSET BCDPATTY SMYTH ISN'T CDSTEPPENWOLF HOLD CDJOE WALSH CARWARREN ZEVON BOOM CDWARREN ZEVON DETOX CDWARREN ZEVON FACTORY CD

YOFM MILWAUKEEP.D. GREG AUSHAMM.D. CHIP HOBART/APDPH: 414-276-2040CON: JON SINTON/JEFF POLLACKMUSIC:TUE MORCALLS:WED-MON 10- 2

MEDIUM ADDSAEROSMITHTHE CARSLIGHT ADDSDAVID BOWIEYST

DUDEYOU

NEVERTEMPTATION

HEAVY38 SPECIAL BACKBRYAN ADAMS HEARTSCRUZADOS iSBiDEF LEPPARD WOMENGRATEFUL DEAD TOUCHGREAT WHITE ROCK

(CDCD

tSAMMY HAGAR

?INSIDERS GHOSTJ.C. MELLENCAMP PAPERMARILLION INCOMMUN aJOHNSTREETSWAITE TIMES

TS

HERE (CD:MEDIUMBEAT FARMERS DARKBRYAN ADAMS VICTIM

tco*ck ROBINDIO DREAMERFABULOUS THIRDS SPELL (CDFIRE TOWN RAINGLEN BURTNICK FOLLOWHOOTERS JOHNNYJON ASTLEY JANE (CDtLOVERBOY NOTORIOUSRICHARD MARX SHOULDMASON RUFFNER WORLD

WHYWILDHEARTSATURDAY CD

DARLINGCD

SUNSETJUSTICEGIVE (CDSTAR

SPANISH(CD

UPDETOX

MELVIN JAMESGARY MOOREOUTFIELD?JEFF PARISPAUL JANZtPAUL KELLYROGER WATERStROBERT VAUGHN

TISTEPPENWOLF

NTU2URGENTJOE WALSHWARREN ZEVONLIGHTHELIX WILDWHITE LION WAIT

NOMF LOUISVILLEP.D. DUKE MEYERM.D. KEITH TAYLORPH: 502-589-4400CON: TOM OWENSMUSIC:MON AFTCALLS:MON-WED 10- 1

HEAVY ADDSTHE CARSLOVERBOY

MEDIUM ADDSAEROSMITHEUROPE

POWERLA BAMBA ST BAMBA

*DEF LEPPARD HYSTERIA?GRATEFUL DEAD TOUCHHEART WHO

*J.C. MELLENCAMP PAPERRICHARD MARX MEANU2tWHITESNAKE HEREFOUNDHEAVY*GRATEFUL DEAD HELL*GINO VANNELLI WILDHUEY LEWIS/NEWS DOINTOM PETTY MIXEDTOM PETTY RUNAWAYSTARSHIP OVERU2JOHN WAITE TIMES

MEDIUMCRUZADOS BEDROGER DALTREY FIREDANNY WILSON PRAYERFABULOUS TBIRDS SPELLSAMMY HAGAR WHATHOOTERS JOHNNYINSIDERS GHOSTRICHARD MARX SHOULDOUTFIELD SINCETOM PETTY THINKPAUL KELLY DARLINGU2 BULLETU2 SPANIJOE WALSH RADIOLIGHTWARREN ZEVON HYGIENE

YOUNOTORIOUS

DUDECARRIE

CCDCDD

CDCD

(CD)

CD

CDCDCDCD

(CDCDCD'CDCDCD

(CD

(CD

(CD

(CC

(CC

WIAS ATLANTAM.D. VALARIE PITTMANPH: 404-658-2240MUSIC:TUE AFT

HEAVY ADDSBELOUIS SOMEDUKE/STRATOSPHRMMNUMADDSTHELONIOUS MONSTHROWING MUSESLIGHT ADDSDUMPTRUCKMOJO NIXONSECTION 25TOM WAITS

LPLP

LPLP

NOWHEREELVIS

HANG

HEAVY10,000 MANIACS PEACEANDY SUMMERS LPTHE CURE HOTCURIOSITY/CAT MISFITDB'S LPDEAD MILKMEN LPECHO/BUNNYMEN NEWFIGURES/BEACH LPHEGE V LPKID CREOLE LPMIGHTY LEMON DR LPM. CRENSHAW WILDPAUL KELLY LPPAUL KING KNOWRITA MITSOUKO LPTHE SILENCERS LPSWING/SISTER LPTIREZ TIREZ LPTOASTERS LPTHAT PETROL EMO LPTOM VERLAINE TOWNPETE WYLIE SINFUL

MEMEXDIUMLPLONELY/EYESORE LPABC WHENNEW MODEL ARMY LPBEAT FARMERS LPCOLOURFIELD LPJOE ELY LPVARIATIONS II LPFACTORY COMPIL. LPFIRE TOWN . LPGO-BETWEENS LPICICLE WORKS LPJON ASTLEY JANELIME SPIDERS LPALISON MOYET ISPRIMITONS LPPETER TOSH LPREDD KROSS LOVEROYAL C. MOB LPSPEAR/DESTINY LPSUZANNE VEGA LPTROUBLE FUNK 12*URBAN BLIGHT LPWILD FLOWERS LPWINDBREAKERS LPWARREN ZEVON LPLIGHTTHE BEARS LPBLEACHED BLACK LPBRIAN BRAIN LPDASH RIPROCK LPDUANE LPERASURE LPFAITH NO MORE WEFATAL FLOWERS LPHOODOO GURUS SCENEHEGE V HOUSEHANOVER FIST AMERICANHURRAH LP

NRCN LONG ISLANDP.D. LENNY BLOCHM.D. JOHN LOSCALZOPH: 516-727-1570MUSIC:TUE AFTCALLS:MON-FRI 10- 5

POWER ADDSTHE CARSHEAVY ADDSAEROSMITHMEDIUM ADDSPAUL CARRACK

LIGHT ADDSENVY

POWER

tU2,J.C. MELLENCAMP PAPER

WHITESNAKESTREETS CDHERE

11CD

GRATEFUL DEAD TOUCHHEART WHO

HEAVYCROWDED HOUSE WORLD (CD)CRUZADOS BED (CD)ROGER DALTREY FIREDEF LEPPARD ANIMALECHO/BUNNYMEN NEWEUROPE CARRIEFLEETWOOD MAC LITTLE

(CD)

GRATEFUL DEAD PUSH alGRATEFUL DEAD HELL

YOU

DUDE

SHED

BELIEVE

SAMMY HAGAR BOYSHOOTERS JOHNNYLOVERBOY NOTORIOUSLIVING/DAY ST WHERETOM PETTY MIXED?REPLACEMENTS ALEXROGERWATERS SUNSETSUZANNE VEGA SOLITUDE 2 CD1

TWISTED SISTER HOTJOE WALSH CAR (CD)MEDIUMBEAT FARMERS DARK,DAVID BOWIE NEVER (CD)?THE BRANDOS GETTYSBURGTHE CURE HEAVENDIO DREAMERFABULOUS TBIRDS SPELLGLEN BURTNICK FOLLOWGREAT WHITE ROCK CDMOTLEY CRUE WILD CD'PAUL KELLY DARLING CDTHE SILENCERS PAINTED CDPATTY SMYTH ISN'T CDWARREN ZEVON DETOX CDLIGHTBACK/BEACH ST PIPELINEFASTER puss*CAT CHANGE (CD)INSIDERS GHOSTMR. MISTER SOMETHINGOMAR/HOWLERS MANPETE GARDENS DREAMSROBERT VAUGHN JUSTICE (CD)STARSHIP BABYLON (CD)STEPPENWOLF HOLDTESLA ROCKURGENT TAKE (CD)

ARDU RALEIGHP.D. BEN BALL (OM)M.D. BOB WALTONPH: 919-782-1061CON: B -A -D -EMUSIC:TUE AFTCALLS:WED-FRI 9-11

HEAVY ADDSTHE CARSMEDIUM ADDSSAMMY HAGARLIGHT ADDSBILLY IDOLTHE BRANDOSEUROPE'MELVIN JAMES

HEAVYLA BAMBA STtJON BUTCHERDEF LEPPARDDEF LEPPARD/FLEETWOOD MACGRATEFUL DEADGRATEFUL DEADGREAT WHITEHOOTERSJ.C. MELLENCAMPJON ASTLEYLOST BOYS ST}ROGER WATERSU2

YOU

HOME

MONYGETTYSBURG (CD)

WHYCARRIE (CD)

BWISHES (CD;ANIMALWOMENLITTLEHELL CD

ROCKTOUCH CDJOHNNYPAPER CDJANE CDGOOD CDSUNSET CDSTREETS CD

WHITESNAKE HERE (CD)MEDIUMTHE BEARS FEAR (CDDEF LEPPARD ARMAGEDDON(CDDEF LEPPARD HYSTERIADEF LEPPARD SUGAR (CDFABULOUS THIRDS SPELL (CDHOOTERS SATELLITEtINSIDERS GHOST (CDLOVERBOY NOTORIOUSLIVING/DAY ST WHERE (CD)MR. MISTER SOMETHINGOMAR/HOWLERS MANTOM PETTY THINKTHE SILENCERS PAINTED

/ ElSTARSHIP BABYLONSTEPPENWOLF HOLD CDSUZANNE VEGA SOLITUDE CDLIGHTTHE CULT WILD

1E1HEGE V BURIALPETE BARDENS DREAMSREPLACEMENTS, ALEX CD

NRIF DETROITP.D. MICHAEL MAYERM.D. JOE URBIELPH: 313-827-9505MUSIC:MON AFTCALLS:WED-TUE 9- 5

HEAVY ADDSTHE CARS YOULIGHT ADDSBILLY IDOLLOVERBOYNEIL YOUNGSTEPPENWOLF

HEAVYLA BAMBA STBRYAN ADAMSROGER DALTREYERIC CLAPTONGRATEFUL DEADGREAT WHITESAMMY HAGAR GIVEHEART WHOJ.C. MELLENCAMP PAPER

/RICHARD MARXOUTFIELDSTARSHIPU2JOHN WAITEJOE WALSHWHITESNAKEMEDIUM38 SPECIALCRUZADOS?FLEETWOOD MACSAMMY HAGARHOOTERS?ROGER WATERSWHITESNAKEWHITESNAKELIGHTBEAT FARMERSDAVID BOWIEBRYAN ADAMSJON BUTCHERFLEETWOOD MACGRATEFUL DEADJON ASTLEYLIVING/DAY STMELVIN JAMESMR. MISTERTOM PETTYPATTY SMYTHJOE WALSH

MONYNOTORIOUSLONELYHOLD

BARHOMEBAFIREHOLDTOUCHROCK

SHOULDHEARTBABYLONSTREETSTIMESUPHERE

BEDBACK

LITTLEEAGLESJOHNNYSUNSETISSTILL

(CD)

SDI

CDCDCDCDCD%CD

)DCD)

IglCD

(CD)

CDCD

DARKNEVER CDVICTIM CDWISHES CDTANGO CD

JANEHELL

CDWHEWHYSSOMETHINGMIXED ((CDISN'T CDCAR CD

W1IK PADUCAH. KYP.D. MIKE SCOTTPH: 502-443-9836MUSIC:TUE AFTCALLS:MON-FRI 10- 5

MEDIUM ADDSTHE CARS YOUFARRENHEIT BAD

LIGHT ADDSDANCETOM KIMMEL

THE CALL WOODSDR'S NEVERGRATEFUL DEAD WEST

HEAVYTHE BEARS FEAR (CD)BEAT FARMERS DARKJON BUTCHER WISHESTHE CALL WANNACHARLIE DANIELS BOGGED S?);*CRUZADOS BED!ROGER DALTREY FIRE

t FABULOUS TBIRDS SPELLER(CD)

GRATEFUL DEAD HELL CDGRATEFUL DEAD TOUCH CD*GREAT WHITE ROCK CDHOOTERS JOHNNY?HOOTERS SATELLITELOST BOYS ST GOODRICHARD MARX SHOULD (CD)TOM PETTY MIXEDPAUL KELLY DARLINGROGER WATERS SUNSET (CD)PATTY SMYTH ISN'TU2 STREETS CD*URGENT TAKE CDJOHN WAITE TIMES CDWARREN ZEVON DETOX

MEDIUMBRYAN ADAMS VICTIM (CD)CROWDED HOUSE WORLDTHE CULT WILDTHE CURE HEAVENECHO/BUNNYMEN NEW

rillCD

FASTER puss*CAT CHANGE,JOHN HIATT THING?LIVING/DAY ST WHEREMASON RUFFNER WORLDRONDO ROCK BOOM

CD

?NEIGHBORHOODS PUREOMAR/HOWLERS MANPETE BARDENS DREAMSROBERT CRAY WOMANREFUGEE SURVIVALREPLACEMENTS ALEX (CD)ROBERT VAUGHN JUSTICE (CD)STEPPENWOLF HOLDTOM KIMMEL FREEDOMtWHITE LION WAITLIGHT ,

BACK/BEACH ST PIPELINEDAVID BOWIE NEVERco*ck ROBIN JUST

(CD))

GLEN BURTNICK FOLLOWGRATEFUL DEAD STONES (CD)PAUL JANZ ONESUZANNE VEGA SOLITUDETOM VERLAINE TOWNPETE WYLIE SINFUL

NRKI DANBURYP.D. BUZZ KNIGHTPH: 203-775-1212CON: B -A -D -E

FROZEN REPORT

POWERBRYAN ADAMS VICTIMGRATEFUL DEAD TOUCHSAMMY HAGAR GIVEHEART WHOHOOTERS JOHNNYJ.C. MELLENCAMP PAPERLOST BOYS ST GOODROGER WATERS RADIOU2 BULLETU2WHITESNAKE HEREHEAVY38 SPECIAL BACKDAVID BOWIE NEVERCROWDED HOUSE WORLDCRUZADOS BEDROGER DALTREY TAKEDEF LEPPARD WOMENDANNY WILSON PRAYERFLEETWOOD MAC TANGO

(CD)

(CD)

r191(CD)

GRATEFUL DEAD HELLGRATEFUL DEAD PUSHLIVING/DAY ST WHEREMASON RUFFNER WORLDROGER WATERS SUNSET

MEDIUMBACK/BEACH ST PIPELINEDAVID BOWIE BANGCHARLIE DANIELS BOGGEDROGER DALTREY FIREDEF LEPPARD LPELTON JOHN CANDLEFABULOUS TBIRDS SPELLTHE FIXX SCAREDFLEETWOOD MAC MIDNIGHT CDGREAT WHITE ROCK CDSAMMY HAGAR BOYS CDSAMMY HAGAR HOMEHOOTERS KARLAHOOTERS SATELLITEINSIDERS GHOSTJON ASTLEY JANESTEVE JONES MERCYRICHARD MARX SHOULDMOTLEY CRUE WILDOMAR/HOWLERS DANCINGPETE BARDENS DREAMSTOM PETTY MIXEDPAUL KELLY DARLINGPATTY SMYTH ISN'T (CD)STEPPENWOLF HOLDSUZANNE VEGA SOLITUDETWISTED SISTER BADWARREN ZEVON DETOXLIGHTTHE BEARS FEARBEAT FARMERS DARK

EUROPE CARRIEREUROPE CARRIE (CD)GLEN BURTNICK FOLLOWG. SATELLITES MYTH (CD)JOHN HIATT THANKJOHN HIATT THING

P.O. GRENGQAJQN

mORRIS'ONPH: 216-492-5630CON: B -A -D -EMUSIC:TUE MORCALLS:MON-FRI 10- 3

HEAVY ADDSAEROSMITHTHE CARS

MEDIUM ADDSSTARSHIPWHITESNAKELIGHT ADDSDAVID BOWIE NEVERMELVIN JAMES WHY

HEAVYtDEF LEPPARD ANIMALGRATEFUL DEAD TOUCHJ.C. MELLENCAMP PAPERJON ASTLEY JANE*WHITESNAKE HEREMEDIUMTHE BEARS FEARCUTTING CREW LOVETHE CULT WILD*DEF LEPPARD EXCITABLEDEF LEPPARD HYSTERIADIO DREAMERFABULOUS THIRDS SPELLGRATEFUL DEAD HELLGRATEFUL DEAD WESTGREAT WHITE ROCKSAMMY HAGAR HOMEHOOTERS JOHNNYINSIDERSLOVERBOYLIVING/DAY STRICHARD MARXOMAR/HOWLERSOMAR/HOWLERSPETE BARDENSPAUL KELLYROGER WATERSTHE SILENCERSSTEPPENWOLF

*SUZANNESUZANNE VEGA

JOHN WAITE*JOE WALSHLIGHTBEAT FARMERS DARKCHARLIE DANIELS BOGGEDFIRE TOWN RAINWARREN ZEVON DETOX

DUDE (CD)DUDE

(CD)

IS

NRUF-FM GAINESVILLEP.D. HARRY GUSCOTTM.D. JASON TYLERPH: 904-392-0771"CON: JEFF POLLACKMUSIC:TUE AFTCALLS:MON-TUE 12- 4

HEAVY ADDSTHE CARS

MEDIUM ADDSAEROSMITHCROWDED HOUSEHEARTHOOTERSWHITESNAKELIGHT ADDSBRIAN MCDONALDJON BUTCHERCUTTING CREW

POWER}BRYAN ADAMSINSIDERSJ.C. MELLENCAMPTOM PETTY

HE2

AVYCHARLIE DANIELStDEF LEPPARD*GRATEFUL DEAD*JON ASTLEY(RICHARD MARXMEDIUMBEAT FARMERSDEF LEPPARDDIOFABULOUS TBIRDSFLEETWOOD MACFIRE TOWNSAMMY HAGARSAMMY HAGARLOVERBOYMELVIN JAMESMR. MISTERREPLACEMENTSROGER WATERSROBERT VAUGHNTHE SILENCERSSTEPPENWOLFTESLAJOE WALSHLIGHT

LIVING/DAY ST

August 21, 1987

YOU

DUDEWORLDWAIT

ISSATELLITE

LIFEWISHESLOVE

VICTIMGHOSTPAPERMIXEDSTREETS

BOGGEDWOMENHELLJANESHOULD

DARKANIMALDREAMERSPELLLITTLERAINBOYSHOMENOTORIOUSWHYSOMETHINGALEXSUNSETJUSTICEPAINTEDHOLDROCK

WHERESTAR

CDCD

(CD)

(CD)

CD

CDCD

GHOSTNOTORIOUSWHERESHOULDHARD (CD)MANDREAMS (CD)DARLINGSUNSET (CD)

HOLDPAINTEDSOLITUDE

TIMESSTREETS CD

CDCAR

9CDCD

CD

CD

CD

/9CDCD

NRVU NASHVILLEP.D. EMILY JOHNSONM.D. JOHN KOSKIPH: 615-322-3691MUSIC:MON MORCALLS:MON-THU 3- 5

HEAVY ADDSOPAL LPMEDIUM ADDSBUCKWHEAT ZYDE. LPSKINNY PUPPY LPWILD FLOWERS LPLIGHT ADDSDUMPTRUCK NOWHERE

HEAVY10,000 MANIACS LPLONELY/EYESORE LPNEW MODEL ARMY LPBLEACHED BLACK LPTH CURE LPTOE DAMASCUS LPtFLESHEATERS LPJESUS/MARY CH APRILMIGHTY LEMON DR LPLIME SPIDERS LP

CDCDCD

CDCD

CDCDCDCD

CDCD'CDCD

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (55)

REPORTSTHEHARD REPORT

CONTINUEDREPLACEMENTS)SONIC YOUTHSCREAMING TREESWAILING/COMPIL.XMEDIUMBEAT FARMERSTHE BRANDOSFOLK DEVILSDINOSAURDEAD MILKMENECHO/BUNNYMENVARIATIONS IILAWNDALEPAUL KELLYROYAL COURT....SAD LOVERSSCRUFFY THE CATTHE SILENCERSTHROWING MUSESTOASTERSTHAT PETROL EMOTOM VERLAINEWARREN ZEVON

YFIXIC FT MYERS

LPLPLPLPLP

LPGETTYSBURGLPLPLPLPLPLPLPCHANGEDLP

LPSOAPLPLPLPLP

P.D. GREG MULLPH: 813-992-6524CON: B -A -D-EMUSIC:TUE AFTCALLS:FRI-MON 2- 6

HEAVY ADDS*AEROSMITH DUDE (CD)THE CARS YOU

MEDIUM ADDSGRATEFUL DEAD WEST PiWHITESNAKE ISLIGHT ADDSTHE BRANDOS GETTYSBURG (CD)CUTTING CREW LOVE CDMELVIN JAMES WHY CDPAUL KELLY DARLING CD

HEAVYCROWDED HOUSE

S*DEFCRUZA LEPPARD

!GRATEFUL DEADGREAT WHITEJ.C. MELLENCAMPJON ASTLEYU2

MMMUMBRYAN ADAMSTHE CULTDEF LEPPARDDEF LEPPARDFABULOUS TBIRDS_FLEETWOOD MAC)GLEN BURTNICKSAMMY HAGAR*INSIDERSLOVERBOYTOM PETTYTHE SILENCERSSTEPPENWOLFSUZANNE VEGAJOE WALSHXWARREN ZEVONLIGHTTHE BEARSBEAT FARMERSJON BUTCHERDIOFIRE TOWNLIVING/DAY STRICHARD MARXTESLA

WORLDBEDHYSTERIAHELLROCKPAPERJANESTREETS

VICTIMWILDROCKETWOMENSPELLTANGOFOLLOWHOMEGHOSTNOTORIOUSMIXEDPAINTEDHOLDSOLITUDECARJULYDETOX

FEARDARKWISHES

RAINWHERESHOULDROCK

V6HE FT LAUDERDALEP.D. C. KENDALL/OMPH: 305-581-1580

iSS;

CD

CD

CD

(CD)

MEDIUM ADDSDAVID BOWIE NEVERGLEN BURTNICK FOLLOWMR. MISTER SOMETHINGSUZANNE VEGA SOLITUDEU2 STREETS

HEAVY38 SPECIAL BACK

THE CARSST BAMBA

THE CARS YOURCHARLIE DANIELS BOGGEDCRUZADOS BEDDEF LEPPARD WOMENFABULOUS THIRDS STANDFLEETWOOD MAC MIDNIGHT

HGERATEART WHOHOOTERS JOHNNYJ.C. MELLENCAMP PAPERJON ASTLEY JANETRICHARD MARX SHOULDTOM PETTY

SPANISHSPANISH

BRYANBRYAN ADAMSDEF LEPPARDGRATEFUL DEADGREAT WHITEHOOTERSLOVERBOYLIVING/DAY STMASON RUFFNERMELVIN JAMESROGER WATERSTHE SILENCERSURGENT

YO-KX PENSACOLAP.D. MARK DAGWELLPH: 904-438-7543CON: B -A -D -EMUSIC:TUE AFTCALLS:THU-MON 9- 5

HEAVY ADDSAEROSMITHTHE CARSWHITESNAKEMEDIUM ADDSSTARSHIP

LIGHT ADDSTHE CULTDEF LEPPARDDIO

HEAVYBRYAN ADAMS_DEF LEPPARDTGREAT WHITEHOOTERSJ.C. MELLENCAMP*JON ASTLEY

DMCRUZADOSFABULOUS TBIRDS

*GRATEFUL DEADINSIDERSILOVERBOYRICHARD MARXMR. MISTERUGHT*DEF LEPPARDSAMMY HAGARTWISTED SISTER

VICTIMANIMALHELLROCKSATELLITENOTORIOUSWHEREWORLDWHYSUNSETPAINTEDTAKE

DUDOUEY

IS

BABYLON

WILDHYSTERIADREAMER

CDCDCDCDCD

CDCDCDCDCDCD

CDCDCDCDCDCD

CD

VICTIM (CD)ANIMALROCKJOHNNYPAPERJANESTREETS

BEDSPELLHELLGHOSTNOTORIOUSSHOULDSOMETHING

WOMEN

HOTBOYS

CHART KEYTop 5 Requests

Increased Rotation

(CD) = CD Airplay

Radio Reports...Monday & Tuesday10am - 7pm EST

piCD

(CD)

VIM SKOWHEGANM.D. DUANE SHERMANPH: 207-474-5171MUSIC:TUE AFTCALLS:TUE 11- 2

MEDIUM ADDSAEROSMITH DUDECUTTING CREW LOVEDUMPTRUCK NOWHEREDURUTTI COLUMN RABBIT

HEGE IMMATERIAL DRIVINGIT'S IMMATERIAL DRIVINGMOJO NIXON ELVISTHE MONKEES HEARTROYAL COURT.... CHANGEDTOM WAITS HANG

HEAVY10,000 MANIACSABCLA BAMBA STBACK/BEACH STTHE BEARSBEAT FARMERSDAVID BOWIEDAVID BOWIE

)THE BRANDOSTHE CALLCRUZADOSTHE CULT

*THE CURETHE CURECURIOSITY CATDEF LEPPARD

EDDY*ECHD/DUANEpUNNYMENFABULOUS TBIRDSDEL FUEGOS*GRATEFUL DEADJ.C. MELLENCAMPJESUS MARY CHLOST BOYS ST

PEACEWHENBAMBAPIPELINELPDARK

NEVERGETTYSBURGWANNABEDWILDHEAVENKISSMISFITWOMENROCKESTRANEW

WESTAN RDHELLPAPERAPRILGOOD

LOST BOYS ST PEOPLELIVING/DAY ST WHEREM. CRENSHAW EASYMASON RUFFNER GYPSYNEIL YOUNG LONGNEW ORDER FAITHREPLACEMENTS ALEXSIMPLE MINDS LPSUZANNE VEGA LPITOM VERLAINE TOWNU2 LU2B40

JULYWARREN ZEVON DETOX

MEDIUMNEW MODEL ARMY LPHWOOD BEYOND COLORBRIAN BRAIN MONKEYTOE

KCRRB

IN JUSTDASH RIPROCK LPDB'SDEAD MILKMEN LPLIE

JOE TEL Ypuss*CAT CHANGE

GLEN BURTNICK FOLLOWGO-BETWEENS LPGUNS N' ROSES WELCOMEHURRAH SWEETICICLE WORKS LPMIGHTY LEMON DR OUTLIME SPIDERS LPLIONS & GHOSTS MARYLUCKY 7 LPMOOD SIX LP*ROGER WATERS SUNSET

WPA HARRISBURGP.D. JEFF KAUFtMANM.D. CHRIS JAMESPH: 717-697-1141CON: JEFF POLLACKMUSIC:TUE MORCALLS:THU-FRI 3- 5

HEAVY ADDSTHE CARSFABULOUS TBIRDS

*GRATEFUL DEADHOOTERSOUTFIELDMEDM ADDS*AEIUR SMITHTHE BRANDOSFLEETWOOD MACOMAR/HOWLERSLIGHT DDSPETE BARDENS DREAMS

HEAVYBRYAN ADAMSCROWDED HOUSE

*DEF LEPPARD)GLEN BURTNICKGRATEFUL DEADGRATEFUL DEADGREAT WHITE_SAMMY HAGARTINSIDERSJ.C. MELLENCAMPJON ASTLEYRICHARD MARXTOM PETTYPAUL KELLYTHE SILENCERSPATTY SMYTHSUZANNEU VEGAWHITESNAKEWENDY WALDMANDIUMBEAT FARMERSDAVID BOWIETHE CULT

*DEF LEPPARDDIO

tEDNVYEUROPELOVERBOYMELVIN JAMESSTARSHIPTOM KIMMELURGENT

LIGHTFIRE TOWN

YOUSPELLSTONES

HEART

DUDEGETTYSBURG

MANLITTLE

VICTIMWORLD (CD)WOMENFOLLOWHELLPUSHROCKBOYSGHOSTPAPER iS131JANE (CD)SHOULDMIXEDDARLINGPAINTED

SOLITUDE(CD)

STREETSISLIVING

(CD)

DARKNEVERWILDANIMALDREAMERBELIEVECARRIENOTORIOUSWHYBABYLON CDDANCE CDTAKE

RAIN (CD)

WJOG ATHENSP.D. DOUG ALLENM.D. ANITA AMMONSPH: 404-542-8466MUSIC:TUE AFTCALLS:MON-WED 3- 4

HEAVY ADDSOPALSKINNY PUPPYTHROWING MUSES

MEDIUM ADDSDUMPTRUCKTOM WAITS

LPLPLP

NOWHEREHANG

HEAVYLONELY/EYESORE LPNEW MODEL ARMY LPBRIAN LPTHE CUREBRA

INLP

DB'S LPDEAD MILKMEN LP

IFOR YOUR/ONLY LPECHO/BUNNYMEN LPFACTORY COMPIL. LPHUGO LARGO LPJANE/ADDICTION LPMIGHTY LEMON DR LPM. CRENSHAW LPOPHELIAS LPNEW ORDER LPRADIO TOKYO LPSIMPLE MINDS LPTHAT PETROL EMO LP

MEDIUMBLEACHED BLACK LPTHE LPDEADCALLKENNEDYS LPJOHN HIATT LPJESUS/MARY CH APRILLAIB LPLIMEACH SPIDERS LP

MOOD IX IPLASTICLAND LPPOP WILL/ITSELF EPPUSHTWANGERS EPSAD LOVERS LPWAILING/COMPIL. LPX LPWARREN ZEVON LP

W/VV CHRISTIANSBURGP.D. PAULA COLEMANM.D. BUTCH LAZORCHAKPH: 703-382-4993MUSIC:TUE AFTCALLS:MON-FRI 2- 3

MEDIUM ADDSTHE CARSLOVERBOY

LIGHT ADDSTHE BRANDOS

YOUNOTORIOUS

GETTYSBURG

DUMPTRUCK NOWHEREFIRE TOWN RAINHURRAH SWEETOUTFIELD HEARTROYAL COURT.... CHANGEDSTARSHIP BABYLONX SEE

HEAVYLA BAMBA STTHE BEARSBEAT FARMERS/BRYAN ADAMSJON BUTCHERCRUZADOS/THE CULTTHE CUREDEF LEPPARDTGRATEFUL DEADSAMMY HAGARHOOTERS

ALEXSUNSETSTREETSJULY

WARREN ZEVON DETOXMEDIUM10,000 MANIACS PEACEDAVID BOWIE NEVERCHARLIE DANIELS BOGGEDTDB'S

IO DREAMERECHO/BUNNYMEN NEWIFLEETWOOD MAC LITTLETGREAT WHITE ROCKICICLE WORKS JANE)MIGHTY LEMON DR LPRICHARD MARX SHOULDMASON RUFFNER WORLDMOTLEY CRUE WILDIRA. MISTER SOMETHINGPAUL KELLY DARLINGTHE SILENCERS PAINTEDPATTY SMYTH ISN'T

)STEPPENWOLF HOLDSUZANNE VEGA SOLITUDEJOE WALSH CARLIGHTDEF LEPPARD HYSTERIAFABULOUS TBIRDS SPELLGLEN BURTNICK FOLLOWJOHN HIATT THINGJON ASTLEY LIPLIME SPIDERS LPMARILLION SUGARM. CRENSHAW MARYNEIGHBORHOODS PURENEIL YOUNG LONELYPETE BARDENS DREAMSWHITESNAKE IS

BAMBAFEARDARKVICTIMWISHESBEDWILDHEAVENWOMENHELLBOYSJOHNNY

J.C. MELLENCAMP PAPERLOST BOYS ST GOODTOM PETTY MIXEDREPLACEMENTSROGER WATERS

2UX

VINCK-FM FLINTP.D. MARK MILLERM.D. LECIA MACRYNPH: 313-744-1570CON: B-A-D-E/JON SINTONMUSIC:TUE EVECALLS:WED-FRI 10- 6

MEDIUM ADDSAEROSMITH DUDELIGHT ADDSPAUL KELLY DARLING

HEAVY38 SPECIAL BACK*LA BAMBA ST BAMBATBRYAN ADAMS VICTIMCRUZADOS BEDDEF LEPPARD WOMEN*GRATEFUL DEAD TOUCHSAMMY HAGAR GIVEtHEART WHOHOOTERS JOHNNYJ.C. MELLENCAMP PAPER*WHITESNAKE HEREMEDIUMCHARLIE DANIELS BOGGEDDEF LEPPARD ANIMALDIOEUROPE CARRIERFABULOUS THIRDS SPELLFABULOUS TBIRDS STANDFLEETWOOD MAC LITTLEGREAT WHITE ROCKSAMMY HAGAR BOYSJON ASTLEYLOVERBOYLIVING/DAY STRICHARD MARXMR. MISTERPETE HARDENSTOM PETTY MIXEDROGER WATERS SUNSETPATTY SMYTH ISN'TTOM KIMMEL FREEDOM

*U2 STREETSJOE WALSH CAR

LIGHTBEAT FARMERSDANNY WILSONINSIDERSTHE SILENCERSTWISTED SISTER HOT

JANENOTORIOUSWHERESHOULDSOMETHINGDREAMS

WNCT PEORIAP.D. PHIL MANICKIM.D. PAUL NELSONPH: 309-674-2000MUSIC:MON AFTCALLS:TUE-FRI 09-12

CCCOCDCDCDCCCDCD

(CD;

CDCD

CD'CDCDCCCDCD

(CD)

CD

CD

DARKPRAYER

PAINTED a

POWER ADDSTHE CARS YOU

MEDIUM ADDSAEROSMITH DUDECUTTING CREW LOVEco*ck ROBIN JUST

POWER38 SPECIAL BACK

)FLEETWOOD MAC LITTLEGRATEFUL DEAD TOUCHHEART WHO

1CDCD

CROWDED HOUSE WORLD

HOOTERS JOHNNYJ.C. MELLENCAMP PAPER CD)RICHARD MARX SHOULD/MR. MISTER SOMETHING CDREO SPEEDWAGON DREAMS

()(CD)

HEAVYIDAVID BOWIE NEVER CDBRYAN ADAMS HEARTS CDBRYAN ADAMS VICTIM CD

*JON BUTCHER WISHES CDDANNY WILSON PRAYER CDFLEETWOOD MAC MIDNIGHT CDGRATEFUL DEAD HELL CDHUEY LEWIS/NEWS DOIN CDJON ASTLEY JANE CDLOST BOYS ST GOOD CD

VEGASPANISHSUZANNEU2 SPANISH

U2 STREETS (CD)*WHITESNAKE HERE (CD)

(CD)

August 21, 198

MEDIUM*BEAT FARMERS DARKCRUZADOS BEDDEF LEPPARD WOMENFABULOUS TBIRDS SPELLSAMMY HAGARINSIDERSLIVING/DAY STOUTFIELDTOM PETTYPAUL KELLYROGER WATERSTHE SILENCERSPATTY SMYTHSTEPPENWOLFJOE WALSHWARREN ZEVON

GHOSTWHERESINCEMIXEDDARLINGSUNSETPAINTEDISN'THOLDCARDETOX

VW/DC WASHINGTONP.D. DAVE BROWN/VPM.D. CURT GARYPH: 202-828-9932CON: HARRIS COMMUNICATIONS

CDCD

CDCDCDCDCDCD

(CD)

POWER ADDSTHE CARS YOUHEAVY ADDSAEROSMITH DUDECUTTING CREW LOVEHUEY LEWIS/NEWS DOINMEDIUM ADDSDEF LEPPARD ANIMALDISORDERLIES ST EDGEEDDIE MONEY SHOULDGARY MOORE FRIDAYSQUEEZE HOUR

POWERLA BAMBA ST SAMBAERIC CLAPTON RUNFLEETWOOD MAC SEVENGRATEFUL DEAD TOUCH

CDHEARTME

WHOJ.C. LLENCAMP PAPERRICHARD MARX MEANSUZANNE VEGA LUKAU2 STREETS

HEAVYWHITESNAKEHERE

DAVID BOWIE NEVERFLEETWOOD MAC LITTLE (CD)GRATEFUL DEAD HELLGRATEFUL DEAD PUSHRICHARD MARX SHOULDTOM PETTY MIXED (CD)ROGER WATERS RADIOU2 CORY (CD)MEDIUMTHE BRANDOS GETTYSBURGCROWDED HOUSE SOMETHING (CD)CROWDED HOUSE WORLD (CD)DEF LEPPARD LOVEDEF LEPPARD WOMENHOOTERS SATELLITEJON ASTLEY JANENEWCITY ROCKERS REVPAUL KELLY DARLINGROGER WATERS SUNSET CDSTARSHIP BABYLON CDU2 BULLET CD

VIINRX PROVIDENCEP.D. DAVE RICHARDSM.D. RONA RICHMANPH: 401-596-7728CON: HARRIS COMMUNICATIONSMUSIC:TUE AFTCALLS:THU-FRI 03-05

HEAVY ADDSHOOTERS ONEMEDIUM ADDSCUTTING CREW LOVE

LIGHT ADDSTHE CURE HEAVENTHE SILENCERS PAINTED

POWER*LA BAMBA ST BAMBATHE YOU

ICROWDEDCARS HOUSE WORLD_ERIC CLAPTON RUN)GRATEFUL DEAD TOUCHEART

PAPERRICHARD

MELLENCAMP PAPERRICHARD MARX MEANSUZANNE VEGA LUKA

HEAVYU2 STREETS

(DAVID BOWIE NEVER

HEARFLEETWOOD MAC LITTLE

HUEYTGIRL

LEWIS/NEWS DOINRICHARD MARX SHOULD

COUNTRYMEDIUM

PETTY MU2MEMUMBRYAN ADAMS VICTIMFLEETWOOD MAC MIDNIGHTGRATEFUL DEADGRATEFUL DEADHOOTERSINSIDERS

pay*PETENgi HARDENSSTTOM PETTYROGER WATERS SUNSETSUZANNE VEGA SOLITUDELIGHTBEAT FARMERSTHE CALLco*ck ROBINFABULOUS TBIRDSFIRE TOWNGLEN BURTNICKREPLACEMENTS,GREGG ROLIESTEPPENWOLF

CDCDCD

CDCD

(CD)

CD

Oi

0);

STONES (CD)SATELLITE

WHEREDREAMS CDRUNAWAY

DARKWANNA (CD)JUSTSPELLRAINFOLLOW (CD)ALEXHANDSHOLD (CD)

VWVTRCKNEAN CITYP.D. SKIP ISLEYM.D. JENNIFER GIPEPH: 301-289-4545MUSIC:TUE AFTCALLS:MON-TUE 3- 5

HEAVY ADDSTHE CARSMEDIUM ADDSAEROSMITHHEARTMR. MISTEROUTFIELDJOE WALSHWHITESNAKELIGHT ADDSDEF LEPPARDMARILLIONSTARSHIP

HEAVY*LA BAMBA STBRYAN ADAMSCRUZADOS*THE CUREFLEETWOOD MACGRATEFUL DEADIGREAT WHITEHOOTERS*J.C. MELLENCAMPTOM PETTY*UyumTBEAT FARMERSDAVID BOWIEJON BUTCHERCROWDED HOUSEDEF LEPPARDEUROPEFABULOUS TBIRDS

')GLEN BURTNICKGRATEFUL DEADGRATEFUL DEADHOOTERSHOOTERS_INSIDERSTJON ASTLEYLOST BOYS STLOVERBOYLIVING/DAY ST

7RICHARD MARX

YOU

DUDEWAITSOMETHINGHEART (CD)

ISCAR

ANIMALSUGARBABYLON

BAMBA CDVICTIM CD

HEAVENCD CDLITTLE 'CDTOUCH CDROCKJOHNNY

CD

PAPER CDMIXED CDSTREETS CD

DARKNEVER CD

WORLDSCDCD

WOMEN CDCARRIE CDSPELL CDFOLLOWHEL (CDWEST (CD))ONESATELLITEGHOSTJANE CDGOOD CDNOTORIOUSWHERESHOULD M

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (56)

REPORTSarilliARD REPORT

MASON RUFFNERMELVIN JAMES

10MAR/HOWLERSPAUL KELLYROGER WATERSTHE SILENCERSWARREN ZEVONLIGHTBACK/BEACH ST

WORWHYMANDARLINGSUNSETPAINTEDDETOX

PIPELINE

INVVUH.VVESTHARTFORDP.D. MARK GREENLANDM.D. MARK GREENLANDPH: 203-243-4725CALLS: MON-FRI 11A -5PMUSIC: MON AFT

ADDSTHE CULTTALKING HEADSTOM WAITSTACKHEADSPEAR/DESTINYSUSAN MARSHALLBELOUIS SOMEHAZEL DEAN*SKINNY PUPPY

HEAVYNEW ORDERLONELY/EYESORELIME SPIDERSTHAT/EMOTIONHAPPY MONDAYSECHO BUNNYMENTHELONIOUS MONSTERENIGMA VARIATIONSFOUR WAY CROSSTHE XJANE'S ADDICITONERIC B.TOM VERLAINEMISSING FOUNDATIONDURUTTI COLUMNSURF MC'SNITZER EBBDISORDERLIESSECTION 25PUBLIC ENEMYdB'SAREA10,000 MANIACSCYNICSPLASTICLANDNEW MODEL ARMYBOOGIE DOWN PROD.WILD FLOWERSSAD LOVER/GIANTSSWING OUT SISTERSWIMMING POOL Q'SERIC RANDOMDEAD MILKMENROYAL COURT/CHINARITA MITSOUKOBEAT FARMERSTOXIMIATOASTERSCURIOUSITY/CATDUANE EDDY

WILDHEYHANGGAMETAKELPLP12"LP

LPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLP

WNW MORGANTOWN WVM.D. SUSAN KENNEDYPH: 304-293-3329MUSIC:TUE AFTCALLS:MON-TUE 12- 6

HEAVY ADDSBUCKWHEAT ZYDE.MIRACLE LEGION

MEDIUM ADDSSKINNY PUPPYTOASTERSTOM WAITS

LPLP

LPLHAP

NG

CDCDCDCDCDCD

HEAVY10,000 MANIACS LPBEAT FARMERS LPTHE

S LPCURE LP

DB'DEAD EN LPECHO/BUNMILNYKMMEN LPFACTORY COMPIL. LPLIME SPIDERS LPNEIGHBORHOODS LPPAUL KELLY LPTHE SILENCERS LPITHELONIOUS MONS LPTIREZ TIREZ LPTHAT PETROL EMO LPTOM VERLAINE LP/WILD FLOWERS LPWINDBREAKERS LPX LPWARREN ZEVON LPMEDIUMLONELY/EYESORE LP63 EYES LPINEW MODEL ARMY LPBACK/BEACH ST LPTHE BRANDOS GETTYSBURGCURIOSITY/CAT LPDINOSAUR LPDAVE PERKINS YOU_DYSLEXIC ART. LP/JOE ELY LPFRENCH/FRITH... LPGRATEFUL DEAD LPIT'S IMMATERIAL DRIVINGICICLE WORKS LPNEW ORDER FAITH!PASSION FODDER 12"POP WILL/ITSELF EPROYAL COURT.... CHANGEDSWIMMING/Q'S EPTHROWING MUSES LPSCREAMING TREES LPWATER WALK LPLIGHTTHE BEARS LPBLEACHED BLACK LPBORDER RADIO LPBELOUIS SOME LET

TOCRUZDAAMASDOS

CUS LPLP

FOLK DEVILS LPDUANE EDDY LPFOR YOUR/ONLY LPVARIATIONS II LPFASTER puss*CAT LPHULA LPLEMON HEADS LPMOOD STRONG ARM L LPNOMAR/HOWLERS LPPLASTICLAND LPSC LPSONIC YOUTH LP

VWILLIAMVQFIT

T -MARK WILLIAMSM.D. KENNY VANEMONPH: 717-748-4038

POWER ADDSTHE CARSMEDIUM ADDSAUTOGRAPHECHO/BUNNYMENFABULOUS THIRDSPRETTY MAIDSWASPWARREN ZEVON

YOU

NEVERLIPSSPELLLOVESCREAMMONKEY

(CD)

(CD)

(CD)

POWER*LA BAMBA ST BAMBABRYAN ADAMS VICTIM (CD)

*DEF LEPPARD WOMEN*EUROPE CARRIEGRATEFUL DEAD HELL

ROCKF?)]GRATEFUL DEAD TOUCH

*GREAT WHITE CDHOOTERS JOHNNYHUEY LEWIS/NEWS DOIN

SiiiJ.C. MELLENCAMP PAPERtLOVERBOY NOTORIOUSU2 STREETS (CD)JOE WALSH CAR

HEAVYBEAT FARMERS DARKDAVID BOWIE NEVER (CD)DEF LEPPARD ANIMAL

TEARDIODEF LEPPARD

DREAMER(CD)

HGLENEART WHBURTNICK FOOLLOW

/INSIDERS iSEGHOST I

JON ASTLEY JANERICHARD MARX SHOULDPAUL KELLY DARLINGPOISON FORGETTHE SILENCERS PAINTEDSTARSHIP BABYLON (CD)WHITESNAKE ISMEDIUMTHE BRANDOS GETTYSBURGCUTTING CREW LOVECROWDED HOUSE WORLD (CD)THE CULT WILDEUROPE DANGER (CD)FASTER puss*CAT CHANGEGRATEFUL DEAD WEST (CD)SAMMY HAGARSAMMY HAGAR PAINHARPO HEARTSHELIX WILDMOTLEY CRUE WILD (CD)MR. MISTER SOMETHINGREO SPEEDWAGON DREAMS

TN URGENT

SUZANNE VEGA SOLITUDE CD

WHITE LION

CD

MCI DANBURYP.D. ANN COREYM.D. KANDI WILKINSPH: 203-792-8666MUSIC:TUE MORCALLS:TUE 12- 6

MENUMIADDSDUMPTRUCK NOWHERESKINNY PUPPY LPLIGHT ADDSFOLK DEVILS 12"IT'S IMMATERIAL DRIVINGROYAL COURT.... CHANGED

HEAVYLONELY/EYESORE LPTHE CURE LPDEAD MILKMEN LPECHO BUNNYMEN LPFACTORY COMPIL. LPICICLE WORKS LPLIME SPIDERS LPRITA MITSOUKO LP/THE SILENCERS LPTHAT PETROL EMO LPX LP

MEDIUMTHE BEARS LPBEAT FARMERS LPBIG BLACK HEADACHEBIG BLACK LPDB'S LPDEPECHE MODE STRANGEDUKE/STRATOSPHR LPFLESH FOR LULU SOONERGO-BETWEENS LPHOODOO GURUS LPHAPPY MONDAYS LPIHURRAH LPJESUS/MARY CH APRILKID CREOLE LPLEDERNACKEN LPMIGHTY LEMON DR LPNEW ORDER FAITHPASSION FODDER 12"POP WILL/ITSELF EPSECESSION 12"SONIC YOUTH LPSWING/SISTER BREAKOUTTACKHEATIDREZ

1 L2P"TIREZTHROWING MUSES SOAPTOM VERLAINE LPURBAN BLIGHT LPWAILING/COMPIL. LPTOM WAITS HANGWILD FLOWERS LPLIGHT10,000 MANIACS PEACENEW MODEL ARMY LPFAITH NO MORE LPHULA LPSPEAR/DESTINY LP

UB40 LPTHIRD WORLD LP

W(LP DAVENPORTP.D. BILL MARTINM.D. HAZ MONTANAPH: 319-326-2541MUSIC:TUE AFTCALLS:FRI 03-06

MEINUMADDSTHE CARS YOU

LIGHTU2

ADDSSTREETS

FABULOUS TBIRDS SPELLINSIDERS GHOST

HEAVY38 SPECIAL BACKBRYAN ADAMS HEARTS

iDISORDERLIES ST EDGEEUROPE CARRIEFLEETWOOD MAC SEVENGRATEFUL DEAD TOUCH

*J.C. MELLENCAMP PAPER CDPAPER CD

SAMMY HAGAR GIVE

LOST BOYS ST GOOD*LOST BOYS ST SHADOWSRICHARD MARX MEANJOHN WAITE TIMES (CD)JOE WALSH RADIOWHITESNAKE HERE (CD)MEDIUMBRYAN ADAMS VICTIMROGER DALTREY FIREGREGG ALLMAN RUNNING*GREAT WHITE ROCK,HOOTERS JOHNNYNON ASTLEY JANELOVERBOY NOTORIOUSRICHARD MARX SHOULDPATTY SMYTH ISN'T (CD)

'JOU2

E WALSH ARS CPANISH

LIGHTDEF LEPPARD WOMENGRATEFUL DEAD HELLTOM PETTY MIXED

CHART KEY* = Top 5 Requests

= Increased Rotation(CD) = CD Airplay

Radio Reports...Monday & Tuesday10am - 7pm EST

(CD)

(CDi

21?);

1/NRC CHARLOTTEP.D. BOB RALEIGHM.D. JUSTIN PHELPSPH: 704-322-1713MUSIC:TUE AFTCALLS:MON 10- 1

HEAVY ADDSTHE CARSMEDIUM! ADDSAEROSMITHFLEETWOOD MACMELVIN JAMES

POWERCRUZADOSGRATEFUL DEAD.HOOTERSfJ.C. MELLENCAMPTOM PETTY

HEAVYLA BARBA ST*BEAT FARMERSBRYAN ADAMS*DEF LEPPARDFABULOUS TBIRDSGREAT WHITE*SAMMY HAGAR/INSIDERSLOVERBOYLIVING/DAY ST

/PAUL KELLYSUZANNE VEGAU2

?WHITESNAKEDWM38 SPECIALDAVID BOWIEDEF LEPPARD

GLEN BURTNICKSAMMY HAGARLOST BOYS STRICHARD MARXMR. MISTERNEIL YOUNG*OMAR/HOWLERSPETE BARDENSJOE WALSHWARREN ZEVONLIGHTTHE BRANDOSWHITESNAKE

YOU

DUDELITTLEWHY

BED (CD)WESTJOHNNY

(CD)

PAPER (CD)MIXED (CD)

BAMBA (CD)DARKVICTIMWOMENSPELLROCKBOYS (CD)GHOSTNOTORIOUSWHEDARLINGSOLITUDESTREETSIS

BACK (CD)NEVER (CD)ANIMALDREAMER (CD)FOLLOWHOMEGOODSHOULD (CD)SOMETHINGaREEN (CD)

DREAMSCARDETOX

GETTYSBURGHERE (CD)

W(RT CHICAGOP.D. NORM WINERM.D. LIN BREHMERPH: 312-545-4900MUSIC:TUE EVECALLS:MON-WED

HEAVY ADDS

MMMUMTHE C ADDARS

SYOU

DB'S LPNEW ORDER LP

HEALA BAMBA ST BAMBATHE BEARS LP

THEDAVICURE

LPDBOWIE DAY

STEVE EARLE LPECHO/BUNNYMEN LPFABULOUS TBIRDS STANDGRATEFUL DEAD TOUCHJOHN HIATT LPJ.C. MELLENCAMP PAPERLIVING/DAY ST WHERETHE LONG RYDERS LPMASON RUFFNER LPNEIL YOUNG LPN. TREMULIS LPtOMAR/HOWLERS LPTOM PETTY MEPAT METHENY LPREPLACEMENTS LPROGER WATERS LPTHE SILENCERS LPSUZANNE VEGA LPU2 LPWASHINGTON SQ. LPWEBB WILDER LPWARREN ZEVON LP

MEDIUMIBALANCING ACT LPBEAT FARMERS DARKBLEACHED BLACKTHE CALL LLPP

BRUCE co*ckBURN LPCOLOURFIELD LPCRUZADOS LP

FLEETWOOD MAC LPFIRE TOWN LPHOOTERS LPINSIDERS GHOSTJESUS/MARY CH APRILJON ASTLEY LPL. WAINWRIGHT LPALISON MOYET LPTHAT PETROL EMO LPTOM VERLAINE TOWN

/WIRE S LPPANISH

X LPLIGHTCHARLIE DANIELS LPJOHN SCOFIELD LPLITTLE STEVEN LP

11TH DREAM DAY LPLITTLE CHARLIE LPJUDY MOWATT LPYELLO JACKETS LPCHIC COREA LPSPECIAL EFX LPMONTREAUX LPBILL LLOYD LPM. BRECKER LPBILL BRUFORD LPROUSERS LPJ. DEJOHNETTE LPD. SANDBORN LPLADYSMITH B.M. LP

W(XP PITTSBURGHP.D. DENIS MCNAMARAM.D. DEB BRADYPH: 412-821-6140MUSIC:TUE AFTCALLS:MON-WED 10-02

HEAVY ADDSTHE CARSECHO/BUNNYMENNEW ORDERSQUEEZEMUNUMADDSYELLO

HEAVYABCANABELOUIS SOMECOLOURFIELDTHE CURETHE CURETHE CUREDEPECHE MODEECHO/BUNNYMENECHO/BUNNYMENGENE LOVES JEZLOST BOYS STALISON MOYETNEW ORDERPET SHOP BOYSPSY FURSPAUL KELLYREPLACEMENTSTHE SILENCERSSIMPLE MINDSSUZANNE VEGASUZANNE VEGATONIO K

YOULIPS1963HOUR

YEAH

WHENLIVINGLETSHEHEAVENHOTPERFECTSTRANGE

NGAMEEW

GOODSUSPICIONWEAKFAITHSINSHOCK

ALEDARXLING

LPAINTEDPEYESOLITUDESEX

U2 LPU2

SPANISHxWARREN ZEVON MONKEY

MEDIUMANDY SUMMERS LOVELA BAMBA ST BAMBAWOOD BEYOND VISIONDAVID BOWIE NEVERDAVID BOWIE TIMEBILLY BRAGG LPTHE CALL WANNA

URCROWDED

EHOUSE WWHYORLD

THE CCURIOSITY/CAT MISFITROGER DALTREY TAKEDANNY WILSON PRAYERERASURE VICTIMFAITH NO MORE WEFAT BOYS WIPEOUT

Y.Y. FRESH FELLOW LPHURRAH IFICICLE WORKS JANEJON ASTLEY JANETHE LONG RYDERS IALISON MOYET ISHARD ONS

LISTENINGPEE

ECHO LISTENINGPEE WEE HERMAN SURFINPRIVATE DOMAIN ABSOLUTEROGER WATERS RADIOTHAT PETROL EMO BIGUB40 CHERRYLIGHTBRIAN BRAIN STYLEFIRE TOWN CARRYJESUS/MARY CH APRIL

WIMP ST.PETERSBURGP.D. CAREY CURELOPM.D. CHARLIE LOGANPH: 813-228-6090CON: JEFF POLLACK

HEAVY ADDS*AEROSMITH DUDETHE CARS YOU

MEDIUM ADDSDAVID BOWIE NEVEROMAR/HOWLERS MANLIGHT DDSTHE BRANDOS GETTYSBURGJOHN HIATT FAITHMELVIN JAMES WHY

POWERHEARTLOST BOYS STRICHARD MARXTESLATHE TRUTHWHIT ESNAKE

HEAVY38 SPECIALBRYAN ADAMS*DEF LEPPARD*DEF LEPPARDDEF LEPPARDEUROPEFLEETWOOD MACFLEETWOOD MACGRATEFUL DEADGRATEFUL DEADGREGG ALLMAN/GREAT WHITESAMMY HAGARSAMMY HAGARHOOTERS JOHNNY*J.C. MELLENCAMP PAPER

AMERICAOUTFIELDOUTFIELDTOM PETTYTOM PETTYTOM PETTYPATTY SMYTHU2U2JOHN WAITEJOE WALSHWHITESNAKEWHITESNAKEMEDIUMACE FREHLEYACE FREHLEY/BEAT FARMERS

*CRUZADOSGLENGLEN BURTNICK/JON ASTLEYLOVERBOYMOTLEY CRUEMOTLEY CRUE!REPLACEMENTSROGER WATERSTWISTED SISTERLIGHTJOE ELYINSIDERSPAUL KELLYSTEPPENWOLFTNTYET

WHOGOOD (CD)SHOULDLITTLEWEAPONSHERE (CD)

BACKONLY (CD)ANIMALARMAGEDDONWOMENCARRIEMIDNIGHT ()SEVEN (CD)HELLTOUCHRUNNINGROCKBOYS

CD

(CD)

LOVE CDME CDRUNAWAY CDISN'TFOUNDSTREETS CDTIMES CDRADIO

STILL (CD)

DARK

INTOROCK

BEDDREAMER

(CD)

FOLLOWJANE (CD)NOTORIOUSGIRLSWILDALEX

HSUNSET (CD)OT

LORDGHOSTDARLINGHOLDSTARTEMPTATION(CD)

%MEW MOBILEP.D. CATT STONEM.D. REBECCA ST.JOHNPH: 205-432-0102MUSIC:TUE MORCALLS:THU-FRI 12- 3

MEDIUM ADDSAEROSMITTHE CARSH YOU

HEAVYBRYAN ADAMS VICTIMFLEETWOOD MAC LITTLE}GRATEFUL DEAD PUSHGRATEFUL DEAD WEST CDHEARTHOOTERS JOHNNY

CD

J.C. MELLENCAMP PAPERIRICHARD MARX SHOULDROGER WATERS POWERSROGER WATERS SUNSETISTARSHIP BABYLONSUZANNE VEGA SOLITUDE (CD)

STREETS (CD)HEREHYGIENE

WHITESNAKEWARREN ZEVONMEDIUMBEAT FARMERS DARKJON BUTCHER WISHESICRUZADOS BEDTHE CURE HEAVENDEF LEPPARD ANIMALDEF LEPPARD WOMENGREAT WHITE ROCK (CD)LOVERBOY NOTORIOUSLIVING/DAY ST WHERENEIL YOUNG QUEEN

IGREGG ROLIE HANDSJOE WALSH HALFJOE WALSH MALIBULIGHT

DBTHE S LIEBRANDOS GETTYSBURG

'

DISORDERLIES ST EDGEECHO/BUNNYMEN BEDTHE FIXX SCAREDSAMMY HAGAR BOYSHOOTERS

ONEERS

GRAVEYARDHOOTINSIDERS GHOSTMARI LLION SUGARMR. MISTER SOMETHING iEgiOUTFIELD BETTERPAUL KELLY DARLING (CD)REPLACEMENTS ALEXTHE SILENCERS PAINTEDSTEPPENWOLF HOLDTOM KIMMEL DANCE 233

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (57)

THE REPORTSVETAPAMNBP.D. PETE BOLGERM.D. JEAN CASHMANPH: 305-624-9490CON: HARRIS COMMUNICATIONSMUSIC:TUE AFTCALLS:THU-MON 10-12

HEAVY ADDSTHE CARS

MEDIUM ADDSBRYAN ADAMSHOOTERS

LIGHT ADDSLOVERBOY

HEAVY*LA BAMBA STBRYAN ADAMSEDDIE MONEYERIC CLAPTONFLEETWOOD MACGRATEFUL DEADHEARTTOM PETTYU2

MEDIUM38 SPECIALDAVID BOWIE,DAVID BOWIEtCUTTING CREWDANNY WILSONELTON JOHNELTON JOHN

YOU

ONEVICTIM

NOTORIOUS

BAMBAHEARTSNIGHTSMISSSEVENTOUCHWHORUNAWAYFOUND

BACK

TIMELOVE

(CD)

CD

NEVER

MADMANPILOT

ERIC CLAPTON RUN (CD)FABULOUS THIRDS STANDFLEETWOOD MAC LITTLEGRATEFUL DEAD HELL

*GRATEFUL DEAD PUSHGRATEFUL DEAD WEST

'HOOTERS SATELLITEHUEY LEWIS/NEWS DOIN (CD)TINSIDERS GHOSTJ.C. MELLENCAMP PAPERRICHARD MARX SHOULD*OUTFIELD SINCETOM PETTY MIXED (CD)*U2 STREETS (CD)tWGHTHITESNAKE HEREUCROWDED HOUSE WORLD (CD)ROGER DALTREY FIREHOOTERS JOHNNYPETE HARDENS DREAMSPATTY SMYTH ISN'TSUZANNE VEGA SOLITUDE (CD)JOHN WAITE TIMES

1H1CD

(CD)

(CD)

VUL-FMATLANTICCITYP.D. STEVE MCNEEM.D. BARBARA VOIGHTPH: 609-522-1416CON: HARRIS COMMUNICATIONSMUSIC:TUE AFTCALLS:FRI-MOH - 2

MEDIUM ADDSHOOTERS ONELIGHT ADDSBILLY IDOL MONYEDDIE MONEY SHOULDGLEN BURTNICK FOLLOW

HEAVYLA SAMBA ST BAMBA

tCTO WCAR S HOUSE WORLDERIC CLAPTON RUNFLEETWOOD MAC SEVEN (CD)

*GRATEFUL DEAD TOUCHHEART WHO (CD)J.C. MELLENCAMP PAPERRICHARD MARX MEAN

*U2 STREETS (CD)MEDIUM

BOWIE NEVER (CD)tCUTTING CREW LOVEFLEETWOOD MAC LITTLE (CD)FLEETWOOD MAC MIDNIGHT (CD)DAN FOGELBERG MATTERGRATEFUL DEAD HELLHUEY LEWIS DOIN

SigRICHARD SHOULDOUTFIELD SINCETOM PETTY MIXEDROGER WATERS SUNSETU2 COUNTRYLIGHTDEF LEPPARD HYSTERIADEF LEPPARD WOMENGRATEFUL DEAD PUSHGRATEFUL DEAD STONESGRATEFUL DEAD WESTGREGG ALLMAN CROSS (CD)HOOTERS FIGHTINHOOTERS HARD*HOOTERS SATELLITEINSIDERS GHOSTJON ASTLEY JANEOMAR/HOWLERS HARDPETER GABRIEL GIVESUZANNESU VEGA SPAN IS

SOLITUDE

JOE WALSH CARWARREN ZEVON DETOXWARREN ZEVON HYGIENE

WIC BEAUFORTP.D. JT STEVENSM.D. ROBIN MUTCHLERPH: 919-728-2019

MEDIUM ADDSTHE CARS YOUFABULOUS TBIRDS SPELLLOVERBOY NOTORIOUSMR. MISTER SOMETHING (CD)U2 STREETS (CD)

LIGHT ADDSAEROSMITH DUDE (CD)CUTTING CREW LOVEMELVIN JAMES WHY

HEAVYLA BAMBA ST BAMBACRUZADOS BED (CD)DANNY WILSON PRAYERFLEETWOOD MAC TANGOGRATEFUL DEAD TOUCH (CD)SAMMY

WHHAGAR GIVE

HEART O*HOOTERS JOHNNYJ.C. MELLENCAMP PAPER (CD)OUTFIELD SINCETOM PETTY MIXEDSTARSHIP OVER (CD)

MEDIUMBEAT FARMERS DARKBRYAN ADAMS DAYTHE CULT*DEF LEPPARDEDDIE MONEYEUROPE/FLEETWOOD MACGRATEFUL DEAD

LOVEWOMENNIGHTSCARRIELITTLEHELL

+GkEAT WHITE ROCKHUEY LEWIS NEWS DOIN*JON ASTLEY JANELITTLE AMERICA FIRELIVING/DAY ST WHERERICHARD MARX MEANGARY MOORE OVERTHE OTHER ONES WEREO SPEEDWAGON VARIETYSTEPPENWOLF HOLDJOE WALSH CAR.WHITESNAKE HERELIGHTDAVID BOWIE NEVERBRYAN ADAMS VICTIMGRATEFUL DEAD PUSHGRATEFUL DEAD WESTINSIDERS GHOSTRICHARD MARX SHOULDPAUL KELLY DARLINGROBERT CRAY WOMANTHE SILENCERS PAINTEDWARREN ZEVON FACTORY

(CD)

iSgi(CD)

(CD)

(CD)

(CD)

VEMALIANnP.D. GLNh HoIXU0M.D. RICK STRAUSSPH: 215-694-0511CON: B -A -D -EMUSIC:TUE AFTCALLS:THU-FRI 1 -

POWER ADDS*AEROSMITHHEAVY ADDSWHITESNAKE

LIGHT ADDSROGER DALTREYBONNIE HAYESOUTFIELDTHE SILENCERS

POWER/BRYAN ADAMSDEF LEPPARDGREAT WHITEHOOTERSJ.C. MELLENCAMP*JON ASTLEY

HEAVY*DAVID BOWIECRUZADOSHEART_HOOTERSfLOVERBOYRICHARD MARXMR. MISTERROGER WATERSDMBEAT FARMERSDEF LEPPARDSAMMY HAGAR,HOOTERSTINSIDERSLIVING DAY ST

LIGHTco*ck ROBINJOE ELYGLEN BURTNICKMELVIN JAMESPETE HARDENS

3

DUDE

IS

FIRESOMEHEARTPAINTED

VICTIMANIMALROCKJOHNNYPAPERJANESTREETS

NEVERBEDGIRLSATELLITENOTORIOUSSHOULDSOMETHINGSUNSET

DARKWOMENHOMEFIGHTINGHOSTWHEREMIXED

JUSTLOFOLRDLOWWHYDREAMS

VZZQ TERRE HAUTEP.D. TODD HOLMANM.D. DAN MICHAELS

HEAVY ADDSAEROSMITH

MEDIUM ADDSTHE CARSDEF LEPPARDMELVIN JAMESTOM PETTY

LIGHT ADDSTHE CULTTOM KIMMELURGENT

POWER/URGENTBRYAN ADAMSBRYAN ADAMSDEF LEPPARDFLEETWOOD MACSAMMY HAGAR

t LOVERBOYRICHARD MARXtOUTFIELDSTARSHIPU2JOE WALSH

HEAVYWHITESNAKEEUROPE CARRIEtFLEETWOOD MAC LITTLEGRATEFUL DEAD TOUCHGREGG ALLMAN RUNNINGGREAT WHITE ROCKHEARTSAMMY HAGAR BOYS

J.C. MELLENCAMP PAPERRICHARD MARX SHOULDMOTLEY CRUE GIRLS

, OUTFIELD SINCEMEDIUM38 SPECIAL BACKACE FREHLEY INTOLA BAMBA ST BAMBABOSTON HOLLYANNJON BUTCHER HOLYTHE CALL WANNACHARLIE DANIELS BOGGEDCRUZADOS BEDDIO . DREAMERDANNY WILSON PRAYERFABULOUS TBIRDS STANDFLEETWOOD MAC MIDNIGHTDAN FOGELBERG SHEFROZEN GHOST ENDINSIDERS GHOSTJUDAS PRIEST ANOTHERLOST BOYS ST GOODMOTLEY CRUE WILDMR. MISTER SOMETHINGNEIL YOUNG LONGREO SPEEDWAGON DREAMSTHE SILENCERS PAINTEDPATTY SMYTH ISN'TTOM KIMMEL FREEDOMTWISTED SISTER HOT

tJOU2 STREETSHN WAITE TIMES

JOE WALSH CARJOE WALSH FUN (CD)tWHITESNAKE ISLIGHTACE FREHLEYBEAT FARMERSDAVID BOWIEDAVID BOWIETHE CULTSTEVE EARLE

DUDE

YOUANIMALWHYMIXED

WILD

TAKEDANCE

(CD)

(CD)

(CD)

(CD)

(CD)

iSE1CD

(CD)

(CD)

(CD)

(CD)

(CD)

FOOLHEARTSVICTIMWOMENSEVENGIVENOTORIOUSMEANHEARTOVERFOUNDRADIOHERE

ROCKDARKNEVERTIMEDEVILSATISFIED

KFMH DAVENPORTP.D. STEVE BRIDGESM.D. PHIL MPH: 319-263-2512MUSIC:TUE MORCALLS:MON-FRI 9- 5

HEAVY ADDSAEROSMITHBILLY IDOLTHE CARSREM

NEDIUM ADDSECHO/BUNNYMENHEGE VLIGHT ADDSDUMPTRUCK NOWHEREROYAL COURT.... CHANGED

HEAVYtBEAT FARMERS DARKBRYAN ADAMS LPJONTHE CALLBUTCHER L LPP

FABULOUS TBIRDS SPELLFABULOUS THIRDS STANDFLEETWOOD MAC LPGRATEFUL DEAD LPGREAT WHITE ROCKSAMMY HAGAR GIVESAMMY HAGAR WHENHEARTtINSIDERSLOST BOYS STLIVING/DAY STMARILLIONOMAR/HOWLERSTOM PETTYROGER WATERS/THE SILENCERSJOE WALSHWHITESNAKEWARREN ZEVON

MEDIUMTHE BEARSDAVID BOWIEco*ck ROBINTHE CUREROGER DALTREYDEF LEPPARDHELIXJOHN HIATTHOOTERS

DUDEMONYYOUONE

LIPSHOUSE

LPGHOSTGOODWHERE

HARDINCOMMUNLPRADIOPAINTEDRADIOLPDETOX

NEVER

WHYJUSTTAKELWILDLJOHNNY

(CD)

(CD)

(CD)

J.C. MELLENCAMP PAPERRICHARD MARX LPMASON RUFFNER LPMOTLEY CRUE GIRLSPAUL KELLY DARLINGSTEPPENWOLF HOLDTHE TRUTH UNTILU2URGENT TAKE

HEAVY METALCHEZ-OTTAWACONTACT: JIM HURCOMBPHONE: 613-563-1919BLOCK PROGRAMSAT 1OPM-1AM

ADDS:STEPPENWOLFWHITE LIONLOUDNESSWASP 12"AEROSMITH DUDE

Top TenDEF LEPPARDDIOACE FREHLEYMOTLEY CRUEGUNS N. ROSESANVILTWISTED SISTERWHITESNAKEFASTER puss*CATHELIX

KCMU-SEATTLECONTACT:JEFF GILBERTPHONE: 206-543-4680BLOCK PROGRAM(BRAIN PAIN)SUN 9 -MID

Top Ten

KING DIAMONDNUCLEAR ASSAULTTESTAMENTDEATH ANGELHELLOWEENANTHRAXWILD DOGSOVERKILLTHE ACCUSEDWEHR MACHT

KFMX-LUBBOCKCONTACT: JEFF WANPHONE: 806-747-1224BLOCK PROGRAMSAT TOPM-IAM

ADDS:YETWASPHELIXCELTIC FROST

Top Ten

ANTHRAXDIOGUNS N. ROSESHELLOWEENYETWHITE LIONHEATHENACE FREHLEYLOUDNESSLEIGE LORD

KISS -SAN ANTONIOCONTACT: JOE ANTHONYPHONE: 512-223-6211BLOCK PROGRAMDAILY IOPM-1AM

Adds:LIZZY BORDENWASP

Top 20

KING DIAMONDANTHRAXGRIM REAPERWHITESNAKEPRETTY MAIDSDEF LEPPARDGREAT WHITEKEELOBSESSIONHEATHENMORTAL SINACE FREHLEYANVILGUNS N' ROSESLIZZY BORDENWASP 12"MANOWARNUCLEAR ASSAULTRIVERS EDGEHELLOWEENTALONYET

KJOT-BOISECONTACT: DAVE STONEPHONE: 208-344-3511BLOCK PROGRAMSAT 10PM-3AM

Adds:

WASPHELIX

Top TenDIOHAWKTROUBLETNTWHITE LIONHELIX

DREAMERVICTIMSRUNSTARHUNGRYWILD

MONTROSE PASSMASI FIREWASP SCREAMKING DIAMOND SHRINE

KTEC- KLAMATH FALLSM.D.: RUDY MENDOZA(ICE CREAM MAN)PH:503-882-1776BLOCK PROGRAMSFRI 6PM-MID

ADDS:DEF LEPPARDARMOURED SAINTHEATHEN

LPLPT .P

Top 20

ANTHRAXKING DIAMONDHEATHENARMOURED ST.GUNS N. ROSESGRIM REAPERNUCLEAR ASSAULTOVERKILLTESTAMENTHELLOWEENSACRED CHILDDIODEF LEPPARDOBSESSIONWILD DOGSEXETONY MACALPINEPRETTY MAIDSOZZY OSBOURNEGOO GOO DOLLS

KUCA-CONWAYCONTACT: BART HALLPHONE: 501-329-6211BLOCK PROGRAMSUN 6-9PM

ADDS:LEIGE LORD

Top TenQUEENSRYCHEDEF LEPPARDTNTMEGADETHOZZY OSBOURNEPRETTY MAIDSHURRICANEANTHRAX 12"EZOWHITE LION

W131M-BRIDGEWATERCONTACT: BOB LANGPHONE: 617-697-1303BLOCK PROGRAMWED 1-4PM

NFLBLACKSETSATURDAYANYTHINGHEAVENNIGHTWRECKINGBURNTHALLOWEENELECTRICDREAMWOMENMONEYSPELLWAR CHILDHUNDREDSLOUDFLYINGFEAR

ADDS:HEATHENDEF LEPPARDCELTIC FROSTEXECUTIONERSPEED METAL HELL III

Top TenHEATHENDEF LEPPARDGUNS N. ROSESCELTIC FROSTEXECUTIONERFASTER puss*CATSHOUTPENTAGRAMTROUBLESPEED METAL HELL III

WEOS-GENEVACONTACT:DON WEEKSHONE:BLOCK PROGRAMSAT 9PM-1AM

ADDS:SPEED METAL HELL IIIEXECUTIONER

Top Ten

CELTIC FROSTEXEHEATHENMORTAL SINNUCLEAR ASSAULTOBSESSIONRUNNING WILDLEIGE LORDINDESTROYHELLOWEEN

WHJY-PROVIDENCECONTACT: DR. METALPHONE: 401-438-6110BLOCK PROGRAMSAT MID-2AM

ADDS:NONE

Top TenWHITESNAKEDIODEF LEPPARDKEELANTHRAXHELLOWEENGRIM REAPERHEATHENHELIXEZO

WJUL-LO WELLCONTACT: BILL FISHERPHONE: 617-459-0579BLOCK PROGRAMTHURS 6-10PM

ADDS:EXECUTIONERHEATHEN

Top Ten

HELLOWEENKING DIAMONDSWORDTROUBLEWHITE LIONSHOUTNUCLEAR ASSAULTDIOEZOOBSESSION

WKNC-RALEIGHP.D. SHAWN LACKEYM.D. DEWEY McCAFFERTYPHONE: 919-737-2401BLOCK PROGRAMMON-FRI 6AM-9PMSAT & SUN FORMAT

ADDS:AEROSMITH DUDEWASP SCREAM 12"HELIX LP

Top TenGREAT WHITEWHITE LIONDIODEF LEPPARDTWISTED SIST.LOUDNESSJEFF PARISYETKEELHAGAR

ALLHUNGRYDREAMHYSTERIALOVEGYPSYWIREDTEMPTATIONLOVEEAGLES

WNGZ-ELMIRACONTACT: JESSICA HARLEYPHONE: 607-535-2779BLOCK PROGRAMMON 1OPM-1AM

ADDS:OBSESSIONWASP 12"NUCLEAR ASSAULT

Top TenHEATHENSWORDANTHRAXOVERKILLHELLOWEENTESTAMENTWHITE LIONTROUBLEEXEEZO

CDLPCD/12"LPHALLOWEENRAGING/OVERHUNGRY/LADY/ALLTHINKINGMARTIAL/SLAYERDESIREE/DESTROY

WNHU-WEST HAVENCONTACT: MIKE ZPHONE: 203-934-8888BLOCK PROGRAMSAT 4P-SUN 3 AM

ADDED:LOUDNESS

Top TinCELTIC FROSTOBSESSIONKING DIAMONDANTHRAXGRIM REAPERTESTAMENTDEATH ANGELHEATHENGUNS N' ROSESLOUDNESS

Z-ROCK-SATTLELITEP.D. WILD BILL SCOTTM.D. MAD MAX HAMMERPHONE: 214-991-920024 HOUR FORMAT

ADDS:LIZZY BORDEN VISUAL LIESMETALLICA GARAGE DAYSRUSH HOLD YOUR FIRE

Top 2$DEF LEPPARDKING DIAMONDGREAT WHITEWHITE SNAKEDIOHELLOWEENGUNS N ROSESYETTROUBLEFASTER puss*CATMOTLEY CRUEANTHRAXACE FREHLEYKEELGRIM REAPERSAMMY HAGARTONY MACAPLINELOUDNESSJUDAS PRIESTNUCLEAR ASSAULTHEATHENAEROSMITH CLASSICOZZY OSBOURNEDIRTY LOOKSSUICIDAL TENDENCIES

WOXY-CINCINNATTICONTACT: KEN GLIDEWELLPHONE: 513-523-4114BLOCK PROGRAMSUN 7-9PM

WRCN-LONG ISLANDCONTACT: BRAD MARTINPHONE: 516-727-1570BLOCK PROGRAMMON-FRI 11PM-MID

WSOU-SOUTH ORANGECONTACT: TINA LANGONEKEVIN CRISTIPHONE: 201-762-8950BLOCK PROGRAM100 HOURS WEEKLY

WUCF-ORLANDOCONTACT: KEVIN NISSLEYPHONE: 305-281-8964BLOCK PROGRAMSUN MID-3AM

WWUH-WEST HARTFORDCONTACT: MARK GREENLANDPHONE: 203-243-4725BLOCK PROGRAMTUES & THURS MID-3AM

WWVU-MORGANTOWNCONTACT: RICH SCROGGSPHONE: 304-293-3329BLOCK PROGRAMFRI MID 2AM

WXRC-CHARLOTTECONTACT: SHELL) B.PHONE: 704-322-1713BLOCK PROGRAMWED 11PM-MID

ADDS:HELIXTNTWASPPOSSESSED

August 21, 1987

Medford Lakes, New Jersey 08055 HARD REPORT'· 8/21/1987 · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (58)

The firs: single from Um album

Medford Lakes, New Jersey 08055 HARD REPORT' · 8/21/1987  · honor among thieves already on at: wnew wbcn wwdc kfog ktxq wllz wynf 91x klol whcn kilo wrcn kzel wour waqx kxrx kjet - [PDF Document] (2024)
Top Articles
Latest Posts
Article information

Author: Geoffrey Lueilwitz

Last Updated:

Views: 5534

Rating: 5 / 5 (80 voted)

Reviews: 95% of readers found this page helpful

Author information

Name: Geoffrey Lueilwitz

Birthday: 1997-03-23

Address: 74183 Thomas Course, Port Micheal, OK 55446-1529

Phone: +13408645881558

Job: Global Representative

Hobby: Sailing, Vehicle restoration, Rowing, Ghost hunting, Scrapbooking, Rugby, Board sports

Introduction: My name is Geoffrey Lueilwitz, I am a zealous, encouraging, sparkling, enchanting, graceful, faithful, nice person who loves writing and wants to share my knowledge and understanding with you.